BLASTX nr result
ID: Phellodendron21_contig00041507
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041507 (295 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006489179.1 PREDICTED: uncharacterized protein LOC102618575 [... 57 2e-08 XP_006419694.1 hypothetical protein CICLE_v10004184mg [Citrus cl... 56 5e-08 >XP_006489179.1 PREDICTED: uncharacterized protein LOC102618575 [Citrus sinensis] Length = 1168 Score = 57.4 bits (137), Expect(2) = 2e-08 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 3/42 (7%) Frame = +2 Query: 122 MGFLGDPDASNDPTKTDTNEDFA---TQVFDSQFSPPPSPGD 238 MG LGD D+ ND +KT+ N+ FA TQVFDSQFSPPPSPG+ Sbjct: 1 MGSLGDGDSPNDSSKTNPNDVFARADTQVFDSQFSPPPSPGE 42 Score = 28.1 bits (61), Expect(2) = 2e-08 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +3 Query: 234 ETQPLDLDAETQALDYFDD 290 ETQ L L ETQALD+F+D Sbjct: 82 ETQALYLGDETQALDFFND 100 >XP_006419694.1 hypothetical protein CICLE_v10004184mg [Citrus clementina] ESR32934.1 hypothetical protein CICLE_v10004184mg [Citrus clementina] Length = 1168 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 27/42 (64%), Positives = 33/42 (78%), Gaps = 3/42 (7%) Frame = +2 Query: 122 MGFLGDPDASNDPTKTDTNEDFA---TQVFDSQFSPPPSPGD 238 MG LGD D+ ND +KT+ N+ FA TQVFDSQFSPPP+PG+ Sbjct: 1 MGSLGDGDSPNDSSKTNPNDVFARADTQVFDSQFSPPPAPGE 42 Score = 28.1 bits (61), Expect(2) = 5e-08 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +3 Query: 234 ETQPLDLDAETQALDYFDD 290 ETQ L L ETQALD+F+D Sbjct: 82 ETQALYLGDETQALDFFND 100