BLASTX nr result
ID: Phellodendron21_contig00041448
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041448 (395 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006428766.1 hypothetical protein CICLE_v10011107mg [Citrus cl... 102 9e-23 XP_006481496.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 1e-21 GAV88336.1 PPR domain-containing protein/PPR_1 domain-containing... 61 2e-08 OMP09232.1 hypothetical protein COLO4_05681 [Corchorus olitorius] 55 2e-06 CDO97701.1 unnamed protein product [Coffea canephora] 55 2e-06 XP_007033459.2 PREDICTED: pentatricopeptide repeat-containing pr... 55 3e-06 EOY04385.1 Tetratricopeptide repeat (TPR)-like superfamily prote... 55 3e-06 >XP_006428766.1 hypothetical protein CICLE_v10011107mg [Citrus clementina] ESR42006.1 hypothetical protein CICLE_v10011107mg [Citrus clementina] Length = 787 Score = 102 bits (254), Expect = 9e-23 Identities = 63/112 (56%), Positives = 72/112 (64%), Gaps = 15/112 (13%) Frame = +1 Query: 103 ICLKLPSIETSSWNLNMQRMSFLSVRKPYQLKPRLCP---RIEASYSLILPHFFCSIH-- 267 I LK I T L +Q M+ +S+ KP+QLKPR+ P RIEA YSLILPHFFCSI+ Sbjct: 22 ISLKESQIPT----LRIQGMALISLSKPHQLKPRVHPIISRIEAPYSLILPHFFCSINDQ 77 Query: 268 ---QGNSAPNLDT-------DGPQRIPSGNPRTPVKLEDIICKLMAERAWTT 393 Q + APN D QRIP GN R+PVKLED ICKLMAERAWTT Sbjct: 78 QQTQDSPAPNPDPFQADEEPSQRQRIPRGNHRSPVKLEDTICKLMAERAWTT 129 >XP_006481496.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37230 [Citrus sinensis] Length = 751 Score = 99.0 bits (245), Expect = 1e-21 Identities = 56/93 (60%), Positives = 64/93 (68%), Gaps = 15/93 (16%) Frame = +1 Query: 160 MSFLSVRKPYQLKPRLCP---RIEASYSLILPHFFCSIH-----QGNSAPNLDT------ 297 M+ +S+ KP+QLKPR+ P RIEA YSLILPHFFCSI+ Q + APN D Sbjct: 1 MALISLSKPHQLKPRVHPIISRIEAPYSLILPHFFCSINDQQQTQDSPAPNPDPFQADEE 60 Query: 298 -DGPQRIPSGNPRTPVKLEDIICKLMAERAWTT 393 QRIP GN R+PVKLED ICKLMAERAWTT Sbjct: 61 PSQRQRIPRGNHRSPVKLEDTICKLMAERAWTT 93 >GAV88336.1 PPR domain-containing protein/PPR_1 domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein [Cephalotus follicularis] Length = 757 Score = 61.2 bits (147), Expect = 2e-08 Identities = 38/98 (38%), Positives = 49/98 (50%), Gaps = 20/98 (20%) Frame = +1 Query: 160 MSFLSVRKPYQLKPRL---CPRIEASYSLILPHFFCSIH-----------QGNSAPNLDT 297 M+ +S+ KPY+LKP++ PRI SYSL HF S Q N P Sbjct: 1 MACISITKPYKLKPKIYPHIPRIPNSYSLCPLHFCTSTEDPAPQPETQPEQANPTPQNGA 60 Query: 298 DGPQRI------PSGNPRTPVKLEDIICKLMAERAWTT 393 + Q P G R P KLED+IC++MA+R WTT Sbjct: 61 ENNQNQLDHTNPPRGKRRNPEKLEDVICRMMAKREWTT 98 >OMP09232.1 hypothetical protein COLO4_05681 [Corchorus olitorius] Length = 725 Score = 55.5 bits (132), Expect = 2e-06 Identities = 40/102 (39%), Positives = 49/102 (48%), Gaps = 24/102 (23%) Frame = +1 Query: 160 MSFLSVRKPYQLKPRLCPRIEASYSLILPHFFC--------SIHQGNSAPN-LDTDGP-- 306 M+F+SV K YQLK R+ P I + + HFFC S Q N+AP D P Sbjct: 1 MAFISVSKTYQLKQRVHPSIPRISNPL--HFFCTTQDPTKESEEQNNAAPQPQQKDAPPQ 58 Query: 307 ------------QRIPS-GNPRTPVKLEDIICKLMAERAWTT 393 QR P G R P K+ED IC++M RAWTT Sbjct: 59 PQQEEEAANVVKQRTPHRGKARNPEKIEDTICRMMESRAWTT 100 >CDO97701.1 unnamed protein product [Coffea canephora] Length = 753 Score = 55.5 bits (132), Expect = 2e-06 Identities = 36/99 (36%), Positives = 43/99 (43%), Gaps = 21/99 (21%) Frame = +1 Query: 160 MSFLSVRKPYQLKPRLCPRIEASYSLILPHFFCSIHQGN-------------SAPNLDTD 300 M++LS KP PR + SL FFCS GN + P Sbjct: 1 MAYLSASKPSHFHPRNLSNVSTPLSLKSLFFFCSSPGGNPDQETAAISPTESTGPETRNV 60 Query: 301 GPQRIPSGNPR--------TPVKLEDIICKLMAERAWTT 393 P PS +PR P KLEDIIC++MA RAWTT Sbjct: 61 DPAATPSRSPRGKHRRLQKNPEKLEDIICRMMANRAWTT 99 >XP_007033459.2 PREDICTED: pentatricopeptide repeat-containing protein At2g37230 [Theobroma cacao] Length = 743 Score = 55.1 bits (131), Expect = 3e-06 Identities = 34/89 (38%), Positives = 46/89 (51%), Gaps = 11/89 (12%) Frame = +1 Query: 160 MSFLSVRKPYQLKPRLCPRIEASYSLILPHFFCSIHQGNSAPN-LDTDGPQR-------- 312 M+F+SV K Y+LKPR RI HFF + ++A L+ PQ+ Sbjct: 1 MAFMSVSKTYKLKPRFYHRISNPL-----HFFTTSQDPSTASQELNNAPPQQEGEKVVTQ 55 Query: 313 --IPSGNPRTPVKLEDIICKLMAERAWTT 393 P G R P K+ED+IC++M RAWTT Sbjct: 56 RTSPRGKTRNPEKVEDVICRMMENRAWTT 84 >EOY04385.1 Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 743 Score = 55.1 bits (131), Expect = 3e-06 Identities = 34/89 (38%), Positives = 46/89 (51%), Gaps = 11/89 (12%) Frame = +1 Query: 160 MSFLSVRKPYQLKPRLCPRIEASYSLILPHFFCSIHQGNSAPN-LDTDGPQR-------- 312 M+F+SV K Y+LKPR RI HFF + ++A L+ PQ+ Sbjct: 1 MAFMSVSKTYKLKPRFYHRISNPL-----HFFTTSQDPSTASQELNNAPPQQEGEKVVTQ 55 Query: 313 --IPSGNPRTPVKLEDIICKLMAERAWTT 393 P G R P K+ED+IC++M RAWTT Sbjct: 56 RTSPRGKTRNPEKVEDVICRMMENRAWTT 84