BLASTX nr result
ID: Phellodendron21_contig00041409
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041409 (309 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007289910.1 Cop c 2-like protein [Marssonina brunnea f. sp. '... 57 1e-07 OCL06512.1 putative thioredoxin [Glonium stellatum] 55 2e-07 XP_020135377.1 thioredoxin [Diplodia corticola] OJD40534.1 thior... 55 2e-07 XP_001799253.1 hypothetical protein SNOG_08948 [Parastagonospora... 52 3e-06 >XP_007289910.1 Cop c 2-like protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] EKD20069.1 Cop c 2-like protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 170 Score = 56.6 bits (135), Expect = 1e-07 Identities = 23/48 (47%), Positives = 32/48 (66%) Frame = -2 Query: 146 LLKPFTSTRNLSSAAVRMGVHNLETKDAYTKALGEDNLIVIDCFATWC 3 L K FT + A MGVHNL+TKD + A+ E+ ++++DCFATWC Sbjct: 41 LTKGFTRRGFSKTTAANMGVHNLKTKDEFEAAINENKIVILDCFATWC 88 >OCL06512.1 putative thioredoxin [Glonium stellatum] Length = 110 Score = 54.7 bits (130), Expect = 2e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -2 Query: 95 MGVHNLETKDAYTKALGEDNLIVIDCFATWC 3 MGVHNLE+K A+ KAL E+ LIV+DCFATWC Sbjct: 1 MGVHNLESKPAFEKALEENKLIVLDCFATWC 31 >XP_020135377.1 thioredoxin [Diplodia corticola] OJD40534.1 thioredoxin [Diplodia corticola] Length = 160 Score = 55.5 bits (132), Expect = 2e-07 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = -2 Query: 128 STRNLSSAAVRMGVHNLETKDAYTKALGEDNLIVIDCFATWC 3 STR S+A RMGVHNL K + AL E L+V+DCFATWC Sbjct: 43 STRLFQSSASRMGVHNLANKTEWDSALQEPELVVLDCFATWC 84 >XP_001799253.1 hypothetical protein SNOG_08948 [Parastagonospora nodorum SN15] EAT84116.1 hypothetical protein SNOG_08948 [Parastagonospora nodorum SN15] Length = 159 Score = 52.4 bits (124), Expect = 3e-06 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = -2 Query: 140 KPFTSTRNLSSAAVRMGVHNLETKDAYTKALGE-DNLIVIDCFATWC 3 K FT+T +S + + GVHNL+T D Y KAL + D+ IV+DCFATWC Sbjct: 40 KFFTTTSKMSES--KQGVHNLQTVDDYRKALEDKDHFIVLDCFATWC 84