BLASTX nr result
ID: Phellodendron21_contig00041286
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041286 (290 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006483018.1 PREDICTED: putative pentatricopeptide repeat-cont... 59 1e-17 XP_006438846.1 hypothetical protein CICLE_v10033965mg [Citrus cl... 59 1e-17 KDO83156.1 hypothetical protein CISIN_1g039715mg [Citrus sinensis] 59 5e-17 OAY39810.1 hypothetical protein MANES_10G123700 [Manihot esculenta] 58 2e-15 XP_007043838.2 PREDICTED: putative pentatricopeptide repeat-cont... 55 3e-15 EOX99670.1 Tetratricopeptide repeat-like superfamily protein [Th... 55 3e-15 XP_010657142.1 PREDICTED: putative pentatricopeptide repeat-cont... 54 9e-15 CAN71462.1 hypothetical protein VITISV_018656 [Vitis vinifera] 54 1e-14 CBI38188.3 unnamed protein product, partial [Vitis vinifera] 54 1e-14 XP_008222365.2 PREDICTED: LOW QUALITY PROTEIN: putative pentatri... 54 2e-14 XP_018859195.1 PREDICTED: putative pentatricopeptide repeat-cont... 54 2e-14 XP_016507584.1 PREDICTED: putative pentatricopeptide repeat-cont... 57 2e-14 XP_009591261.1 PREDICTED: putative pentatricopeptide repeat-cont... 57 2e-14 XP_009378828.1 PREDICTED: putative pentatricopeptide repeat-cont... 54 3e-14 XP_002304652.2 pentatricopeptide repeat-containing family protei... 55 4e-14 XP_008390176.1 PREDICTED: putative pentatricopeptide repeat-cont... 54 5e-14 XP_010110214.1 hypothetical protein L484_009819 [Morus notabilis... 53 5e-14 GAV71480.1 PPR domain-containing protein/PPR_2 domain-containing... 55 5e-14 XP_017192119.1 PREDICTED: putative pentatricopeptide repeat-cont... 54 5e-14 XP_012088740.1 PREDICTED: putative pentatricopeptide repeat-cont... 57 8e-14 >XP_006483018.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Citrus sinensis] XP_015387253.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Citrus sinensis] XP_015387254.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Citrus sinensis] Length = 832 Score = 58.5 bits (140), Expect(2) = 1e-17 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 201 GIPFQPSVMVWRALHGACVIYNNVEIGRL 287 GIPFQPSVM+WRAL GAC+I+NNVEIGRL Sbjct: 622 GIPFQPSVMIWRALLGACIIHNNVEIGRL 650 Score = 58.2 bits (139), Expect(2) = 1e-17 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQ 201 MV DYGIEP EHYTS+V LLGRAGHLD AA+LI+ Sbjct: 587 MVADYGIEPCIEHYTSMVSLLGRAGHLDKAAKLIE 621 >XP_006438846.1 hypothetical protein CICLE_v10033965mg [Citrus clementina] ESR52086.1 hypothetical protein CICLE_v10033965mg [Citrus clementina] Length = 832 Score = 58.5 bits (140), Expect(2) = 1e-17 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 201 GIPFQPSVMVWRALHGACVIYNNVEIGRL 287 GIPFQPSVM+WRAL GAC+I+NNVEIGRL Sbjct: 622 GIPFQPSVMIWRALLGACIIHNNVEIGRL 650 Score = 58.2 bits (139), Expect(2) = 1e-17 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQ 201 MV DYGIEP EHYTS+V LLGRAGHLD AA+LI+ Sbjct: 587 MVADYGIEPCIEHYTSMVSLLGRAGHLDKAAKLIE 621 >KDO83156.1 hypothetical protein CISIN_1g039715mg [Citrus sinensis] Length = 805 Score = 58.5 bits (140), Expect(2) = 5e-17 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 201 GIPFQPSVMVWRALHGACVIYNNVEIGRL 287 GIPFQPSVM+WRAL GAC+I+NNVEIGRL Sbjct: 606 GIPFQPSVMIWRALLGACIIHNNVEIGRL 634 Score = 56.2 bits (134), Expect(2) = 5e-17 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQ 201 MV +YGIEP EHYTS+V LLGRAGHLD AA+LI+ Sbjct: 571 MVANYGIEPCIEHYTSMVSLLGRAGHLDKAAKLIE 605 >OAY39810.1 hypothetical protein MANES_10G123700 [Manihot esculenta] Length = 824 Score = 57.8 bits (138), Expect(2) = 2e-15 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 MV+DYGIEP EHYT +V LLG++GHLD AA+LI+E F Sbjct: 579 MVQDYGIEPCMEHYTCMVSLLGKSGHLDKAAKLIEEIPF 617 Score = 51.6 bits (122), Expect(2) = 2e-15 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIG 281 IPF+PSVMVWRAL GACVIYN+VE+G Sbjct: 615 IPFEPSVMVWRALLGACVIYNDVELG 640 >XP_007043838.2 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Theobroma cacao] XP_007043839.2 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Theobroma cacao] XP_017971315.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Theobroma cacao] XP_017971316.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Theobroma cacao] Length = 833 Score = 54.7 bits (130), Expect(2) = 3e-15 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGRL 287 IPF+PSVMVWRAL GAC+I+NNVE+GRL Sbjct: 624 IPFEPSVMVWRALLGACIIHNNVELGRL 651 Score = 53.9 bits (128), Expect(2) = 3e-15 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 MV+DYGIEP EHY+ +V LLGR+GHL AA+LI+E F Sbjct: 588 MVQDYGIEPCIEHYSCMVWLLGRSGHLYKAAKLIEEIPF 626 >EOX99670.1 Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 833 Score = 54.7 bits (130), Expect(2) = 3e-15 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGRL 287 IPF+PSVMVWRAL GAC+I+NNVE+GRL Sbjct: 624 IPFEPSVMVWRALLGACIIHNNVELGRL 651 Score = 53.9 bits (128), Expect(2) = 3e-15 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 MV+DYGIEP EHY+ +V LLGR+GHL AA+LI+E F Sbjct: 588 MVQDYGIEPCIEHYSCMVWLLGRSGHLYKAAKLIEEIPF 626 >XP_010657142.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] XP_010657152.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] XP_010657164.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] XP_010657166.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] XP_019078048.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] XP_019078052.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] XP_019078053.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] XP_019078055.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vitis vinifera] Length = 828 Score = 53.9 bits (128), Expect(2) = 9e-15 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 M++D+GIEP EHYT +V LLGR GHLD A +LI E F Sbjct: 583 MIQDHGIEPCIEHYTCMVWLLGRGGHLDKAVKLIDEIPF 621 Score = 53.1 bits (126), Expect(2) = 9e-15 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGRL 287 IPFQPSVMVWRAL GACVI+N++E+GR+ Sbjct: 619 IPFQPSVMVWRALLGACVIHNDIELGRI 646 >CAN71462.1 hypothetical protein VITISV_018656 [Vitis vinifera] Length = 787 Score = 53.9 bits (128), Expect(2) = 1e-14 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 M++D+GIEP EHYT +V LLGR GHLD A +LI E F Sbjct: 542 MIQDHGIEPCIEHYTCMVWLLGRGGHLDKAVKLIDEIPF 580 Score = 53.1 bits (126), Expect(2) = 1e-14 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGRL 287 IPFQPSVMVWRAL GACVI+N++E+GR+ Sbjct: 578 IPFQPSVMVWRALLGACVIHNDIELGRI 605 >CBI38188.3 unnamed protein product, partial [Vitis vinifera] Length = 744 Score = 53.9 bits (128), Expect(2) = 1e-14 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 M++D+GIEP EHYT +V LLGR GHLD A +LI E F Sbjct: 499 MIQDHGIEPCIEHYTCMVWLLGRGGHLDKAVKLIDEIPF 537 Score = 53.1 bits (126), Expect(2) = 1e-14 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGRL 287 IPFQPSVMVWRAL GACVI+N++E+GR+ Sbjct: 535 IPFQPSVMVWRALLGACVIHNDIELGRI 562 >XP_008222365.2 PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Prunus mume] Length = 823 Score = 53.9 bits (128), Expect(2) = 2e-14 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 MV++Y +EP EHYT +V LLGR+GHLD A +LIQE F Sbjct: 578 MVQNYDVEPCVEHYTCMVWLLGRSGHLDKAVKLIQEIPF 616 Score = 52.4 bits (124), Expect(2) = 2e-14 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGRL 287 IPF+PSVMVWRAL GACVI+N+VE+GR+ Sbjct: 614 IPFEPSVMVWRALLGACVIHNDVELGRI 641 >XP_018859195.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Juglans regia] XP_018859196.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Juglans regia] XP_018859197.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Juglans regia] Length = 834 Score = 54.3 bits (129), Expect(2) = 2e-14 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGRL 287 IPF+PSVMVWRAL GACVI+NNVE+GR+ Sbjct: 625 IPFEPSVMVWRALLGACVIHNNVELGRI 652 Score = 51.6 bits (122), Expect(2) = 2e-14 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 MV DY IEP EHYT +V LLGR+GHLD + +LI++ F Sbjct: 589 MVHDYSIEPCIEHYTCMVWLLGRSGHLDKSIKLIEQIPF 627 >XP_016507584.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Nicotiana tabacum] Length = 827 Score = 56.6 bits (135), Expect(2) = 2e-14 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 M++DYGIEPS EHYT +V LLGR GHLD A +LI++ F Sbjct: 582 MLDDYGIEPSVEHYTCMVSLLGRLGHLDKAVKLIEDIPF 620 Score = 49.3 bits (116), Expect(2) = 2e-14 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGR 284 IPF+PSVMVWRAL GACV++N VE+G+ Sbjct: 618 IPFEPSVMVWRALLGACVLHNEVELGK 644 >XP_009591261.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Nicotiana tomentosiformis] Length = 827 Score = 56.6 bits (135), Expect(2) = 2e-14 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 M++DYGIEPS EHYT +V LLGR GHLD A +LI++ F Sbjct: 582 MLDDYGIEPSVEHYTCMVSLLGRLGHLDKAVKLIEDIPF 620 Score = 49.3 bits (116), Expect(2) = 2e-14 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGR 284 IPF+PSVMVWRAL GACV++N VE+G+ Sbjct: 618 IPFEPSVMVWRALLGACVLHNEVELGK 644 >XP_009378828.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Pyrus x bretschneideri] Length = 833 Score = 53.5 bits (127), Expect(2) = 3e-14 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 MV+DY +EP EHYT +V LLGR+GHLD A +LI E F Sbjct: 588 MVQDYDVEPCIEHYTCMVWLLGRSGHLDKAVKLINEIPF 626 Score = 52.0 bits (123), Expect(2) = 3e-14 Identities = 21/28 (75%), Positives = 27/28 (96%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGRL 287 IPF+PS+MVWRAL GACVI+N+VE+GR+ Sbjct: 624 IPFEPSIMVWRALLGACVIHNDVELGRM 651 >XP_002304652.2 pentatricopeptide repeat-containing family protein [Populus trichocarpa] EEE79631.2 pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 820 Score = 55.1 bits (131), Expect(2) = 4e-14 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 MVE+Y IEP EHYT +V LLGR+GHLD AA+L+ E F Sbjct: 575 MVEEYDIEPCAEHYTCMVWLLGRSGHLDKAAKLVHEIPF 613 Score = 50.1 bits (118), Expect(2) = 4e-14 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGRL 287 IPF+PSVMVWRAL ACVI+N+VE+GR+ Sbjct: 611 IPFEPSVMVWRALLSACVIHNDVELGRI 638 >XP_008390176.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Malus domestica] XP_008390177.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Malus domestica] XP_008390178.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Malus domestica] XP_017192118.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Malus domestica] Length = 833 Score = 53.5 bits (127), Expect(2) = 5e-14 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 MV+DY +EP EHYT +V LLGR+GHLD A +LI E F Sbjct: 588 MVQDYDVEPCIEHYTCMVWLLGRSGHLDKAVKLINEIPF 626 Score = 51.2 bits (121), Expect(2) = 5e-14 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGR 284 IPF+PS+MVWRAL GACVI+N+VE+GR Sbjct: 624 IPFEPSIMVWRALLGACVIHNDVELGR 650 >XP_010110214.1 hypothetical protein L484_009819 [Morus notabilis] EXC25511.1 hypothetical protein L484_009819 [Morus notabilis] Length = 833 Score = 52.8 bits (125), Expect(2) = 5e-14 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGRL 287 +PF+PSVMVWRAL GACVI+NNVE+G+L Sbjct: 624 MPFEPSVMVWRALLGACVIHNNVELGKL 651 Score = 52.0 bits (123), Expect(2) = 5e-14 Identities = 22/39 (56%), Positives = 29/39 (74%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 M++DYGIEP EHYT ++ L GR GHL+ A +LI+E F Sbjct: 588 MIQDYGIEPCMEHYTCMIGLFGRLGHLNKAVKLIEEMPF 626 >GAV71480.1 PPR domain-containing protein/PPR_2 domain-containing protein/DYW_deaminase domain-containing protein [Cephalotus follicularis] Length = 830 Score = 55.5 bits (132), Expect(2) = 5e-14 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 MVEDYGIEP EHY+ +V LLGR+GHLD A +LI++ F Sbjct: 585 MVEDYGIEPCKEHYSCMVWLLGRSGHLDKALKLIEDIPF 623 Score = 49.3 bits (116), Expect(2) = 5e-14 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGRL 287 IPF+PSVMVWRAL GACVI+NNV +G + Sbjct: 621 IPFEPSVMVWRALLGACVIHNNVVLGSI 648 >XP_017192119.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X2 [Malus domestica] Length = 792 Score = 53.5 bits (127), Expect(2) = 5e-14 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQESRF 213 MV+DY +EP EHYT +V LLGR+GHLD A +LI E F Sbjct: 588 MVQDYDVEPCIEHYTCMVWLLGRSGHLDKAVKLINEIPF 626 Score = 51.2 bits (121), Expect(2) = 5e-14 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGR 284 IPF+PS+MVWRAL GACVI+N+VE+GR Sbjct: 624 IPFEPSIMVWRALLGACVIHNDVELGR 650 >XP_012088740.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Jatropha curcas] XP_012088741.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Jatropha curcas] Length = 830 Score = 56.6 bits (135), Expect(2) = 8e-14 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 97 MVEDYGIEPSTEHYTSVVLLLGRAGHLDNAAQLIQE 204 MVEDYGIEP EHYT +V LLGR+GHLD A +LI++ Sbjct: 585 MVEDYGIEPCMEHYTCMVWLLGRSGHLDKAVKLIEQ 620 Score = 47.4 bits (111), Expect(2) = 8e-14 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = +3 Query: 204 IPFQPSVMVWRALHGACVIYNNVEIGRL 287 IP +PSV VWRAL GACVI+N+VE+GR+ Sbjct: 621 IPVEPSVTVWRALLGACVIHNDVELGRI 648