BLASTX nr result
ID: Phellodendron21_contig00041062
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041062 (540 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007410778.1 hypothetical protein MELLADRAFT_63613 [Melampsora... 89 2e-17 >XP_007410778.1 hypothetical protein MELLADRAFT_63613 [Melampsora larici-populina 98AG31] EGG06127.1 hypothetical protein MELLADRAFT_63613 [Melampsora larici-populina 98AG31] Length = 1180 Score = 89.4 bits (220), Expect = 2e-17 Identities = 42/68 (61%), Positives = 55/68 (80%) Frame = -1 Query: 303 MSKDSGHPTLRRAAVVFLLSSLSTDACGVNIKWKTQYLAKTVRVLRYVKLVDPDALVQHQ 124 +SKDSGHP LRR+A++FLL +LS + ++ W+ +YL KT+RVL YVKLVDPD LVQHQ Sbjct: 1109 VSKDSGHPALRRSAIMFLLITLSLNVDQLDRLWRQEYLTKTIRVLEYVKLVDPDGLVQHQ 1168 Query: 123 AGAALEHL 100 A AA+E+L Sbjct: 1169 ANAAVENL 1176