BLASTX nr result
ID: Phellodendron21_contig00041039
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041039 (282 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003320373.2 hypothetical protein PGTG_01285 [Puccinia gramini... 104 2e-25 OAV90580.1 hypothetical protein PTTG_06177 [Puccinia triticina 1... 103 8e-25 KNE91617.1 hypothetical protein PSTG_14969 [Puccinia striiformis... 101 3e-24 XP_007403649.1 hypothetical protein MELLADRAFT_32625 [Melampsora... 99 1e-23 XP_007764647.1 phosphatidylinositol synthase [Coniophora puteana... 99 1e-23 XP_007321911.1 hypothetical protein SERLADRAFT_475428 [Serpula l... 99 2e-23 KIL69674.1 hypothetical protein M378DRAFT_184084 [Amanita muscar... 99 2e-23 KZP24798.1 CDP-diacylglycerol--inositol 3-phosphatidyltransferas... 99 2e-23 XP_009541809.1 hypothetical protein HETIRDRAFT_44242 [Heterobasi... 99 2e-23 OAX43583.1 phosphatidylinositol synthase [Rhizopogon vinicolor A... 99 2e-23 KIK49357.1 hypothetical protein CY34DRAFT_797303 [Suillus luteus... 99 2e-23 KNZ74203.1 hypothetical protein J132_07515 [Termitomyces sp. J132] 98 4e-23 XP_014569201.1 hypothetical protein L969DRAFT_102063 [Mixia osmu... 99 6e-23 KIM80756.1 hypothetical protein PILCRDRAFT_97796 [Piloderma croc... 97 9e-23 KDQ33223.1 hypothetical protein PLEOSDRAFT_1060887 [Pleurotus os... 97 1e-22 KIK98857.1 hypothetical protein PAXRUDRAFT_823411 [Paxillus rubi... 97 1e-22 KIJ16835.1 CDP-diacylglycerol---inositol 3-phosphatidyltransfera... 97 1e-22 KIJ68964.1 hypothetical protein HYDPIDRAFT_80498 [Hydnomerulius ... 97 2e-22 KII88654.1 hypothetical protein PLICRDRAFT_161959 [Plicaturopsis... 97 2e-22 XP_001874820.1 phosphatidylinositol synthase [Laccaria bicolor S... 96 2e-22 >XP_003320373.2 hypothetical protein PGTG_01285 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP75954.2 hypothetical protein PGTG_01285 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 269 Score = 104 bits (259), Expect = 2e-25 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -1 Query: 171 PQRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 P +DENVFLF+PNLIGY+RIILAAVSLHFMSYHP YCTIAYI+SQLLDAVDGQ AR Sbjct: 32 PSTSDENVFLFLPNLIGYTRIILAAVSLHFMSYHPIYCTIAYIISQLLDAVDGQVAR 88 >OAV90580.1 hypothetical protein PTTG_06177 [Puccinia triticina 1-1 BBBD Race 1] Length = 282 Score = 103 bits (256), Expect = 8e-25 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -1 Query: 171 PQRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 P +DENVFLF+PNLIGY+RIILAAVSLHFMSYHP YCTIAYI+SQLLDAVDGQ AR Sbjct: 47 PCASDENVFLFLPNLIGYTRIILAAVSLHFMSYHPIYCTIAYIISQLLDAVDGQVAR 103 >KNE91617.1 hypothetical protein PSTG_14969 [Puccinia striiformis f. sp. tritici PST-78] Length = 272 Score = 101 bits (251), Expect = 3e-24 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 171 PQRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 P DENVFLF+PNLIGY+RI+LAAVSLH+MSYHP YCTIAYI+SQLLDAVDGQ AR Sbjct: 33 PAAYDENVFLFLPNLIGYTRIVLAAVSLHYMSYHPIYCTIAYIISQLLDAVDGQVAR 89 >XP_007403649.1 hypothetical protein MELLADRAFT_32625 [Melampsora larici-populina 98AG31] EGG12711.1 hypothetical protein MELLADRAFT_32625, partial [Melampsora larici-populina 98AG31] Length = 217 Score = 98.6 bits (244), Expect = 1e-23 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -1 Query: 147 FLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 FLFVPNLIGYSRIILAAVSLH+MSYHPKYCTIAY++SQLLDAVDGQAAR Sbjct: 1 FLFVPNLIGYSRIILAAVSLHYMSYHPKYCTIAYLISQLLDAVDGQAAR 49 >XP_007764647.1 phosphatidylinositol synthase [Coniophora puteana RWD-64-598 SS2] EIW85016.1 phosphatidylinositol synthase [Coniophora puteana RWD-64-598 SS2] Length = 259 Score = 99.4 bits (246), Expect = 1e-23 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPNLIGY+RI+LA +SLHFMSYHPKYCTIAY+VS LLDAVDGQAAR Sbjct: 34 QTYSENVFLFVPNLIGYTRILLAGLSLHFMSYHPKYCTIAYVVSCLLDAVDGQAAR 89 >XP_007321911.1 hypothetical protein SERLADRAFT_475428 [Serpula lacrymans var. lacrymans S7.9] EGN95422.1 hypothetical protein SERLA73DRAFT_186404 [Serpula lacrymans var. lacrymans S7.3] EGO20954.1 hypothetical protein SERLADRAFT_475428 [Serpula lacrymans var. lacrymans S7.9] Length = 263 Score = 99.4 bits (246), Expect = 2e-23 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPNLIGY+RIILA +SLHFMSYHPKYCT+AY+VS LLDAVDGQAAR Sbjct: 34 QSYSENVFLFVPNLIGYTRIILAGLSLHFMSYHPKYCTLAYVVSCLLDAVDGQAAR 89 >KIL69674.1 hypothetical protein M378DRAFT_184084 [Amanita muscaria Koide BX008] Length = 251 Score = 99.0 bits (245), Expect = 2e-23 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPNLIGY+RIILA +SLHFMSYHPKYCT+AY++S LLDAVDGQAAR Sbjct: 32 QSYSENVFLFVPNLIGYTRIILAGLSLHFMSYHPKYCTLAYVISCLLDAVDGQAAR 87 >KZP24798.1 CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Fibulorhizoctonia sp. CBS 109695] Length = 275 Score = 99.4 bits (246), Expect = 2e-23 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPNLIGY+R+ILA VSLH+MSYHPKYCT+AY+VS LLDAVDGQAAR Sbjct: 33 QTYSENVFLFVPNLIGYARVILAGVSLHYMSYHPKYCTVAYVVSCLLDAVDGQAAR 88 >XP_009541809.1 hypothetical protein HETIRDRAFT_44242 [Heterobasidion irregulare TC 32-1] ETW85787.1 hypothetical protein HETIRDRAFT_44242 [Heterobasidion irregulare TC 32-1] Length = 257 Score = 99.0 bits (245), Expect = 2e-23 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPNLIGYSR++LAAV+LHFMSYHPKYCT+AY +S LLDAVDGQAAR Sbjct: 29 QTYSENVFLFVPNLIGYSRVLLAAVALHFMSYHPKYCTLAYCISCLLDAVDGQAAR 84 >OAX43583.1 phosphatidylinositol synthase [Rhizopogon vinicolor AM-OR11-026] Length = 262 Score = 99.0 bits (245), Expect = 2e-23 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPNLIGY+RIILA +SLHFMSYHPKYCT+AY++S LLDAVDGQAAR Sbjct: 34 QTYSENVFLFVPNLIGYTRIILAGLSLHFMSYHPKYCTLAYVISCLLDAVDGQAAR 89 >KIK49357.1 hypothetical protein CY34DRAFT_797303 [Suillus luteus UH-Slu-Lm8-n1] Length = 262 Score = 99.0 bits (245), Expect = 2e-23 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPNLIGY+RIILA +SLHFMSYHPKYCT+AY++S LLDAVDGQAAR Sbjct: 34 QTYSENVFLFVPNLIGYTRIILAGLSLHFMSYHPKYCTLAYVISCLLDAVDGQAAR 89 >KNZ74203.1 hypothetical protein J132_07515 [Termitomyces sp. J132] Length = 246 Score = 97.8 bits (242), Expect = 4e-23 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPNLIGYSRI+LA +SLHFMSYHPKYCT+ Y+VS LLDAVDGQAAR Sbjct: 30 QTYSENVFLFVPNLIGYSRILLAGLSLHFMSYHPKYCTLLYVVSCLLDAVDGQAAR 85 >XP_014569201.1 hypothetical protein L969DRAFT_102063 [Mixia osmundae IAM 14324] GAA98284.1 hypothetical protein E5Q_04967 [Mixia osmundae IAM 14324] KEI40566.1 hypothetical protein L969DRAFT_102063 [Mixia osmundae IAM 14324] Length = 302 Score = 98.6 bits (244), Expect = 6e-23 Identities = 44/57 (77%), Positives = 52/57 (91%) Frame = -1 Query: 171 PQRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 P TDENVFLFVPN++GY+R++LA V+L FMSYHPKYCT+AYI+S LLDAVDGQAAR Sbjct: 58 PGMTDENVFLFVPNIVGYTRVLLAGVALTFMSYHPKYCTVAYIISCLLDAVDGQAAR 114 >KIM80756.1 hypothetical protein PILCRDRAFT_97796 [Piloderma croceum F 1598] Length = 249 Score = 97.1 bits (240), Expect = 9e-23 Identities = 44/56 (78%), Positives = 51/56 (91%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPNLIGY+R+ILA +SLHFMS+HPKYCT+AY++S LLDAVDGQAAR Sbjct: 16 QTYSENVFLFVPNLIGYTRVILAGLSLHFMSFHPKYCTLAYVISCLLDAVDGQAAR 71 >KDQ33223.1 hypothetical protein PLEOSDRAFT_1060887 [Pleurotus ostreatus PC15] Length = 261 Score = 97.1 bits (240), Expect = 1e-22 Identities = 43/56 (76%), Positives = 52/56 (92%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPN+IGY+R++LAA+S+H+MSYHPKYCT+AY+VS LLDAVDGQAAR Sbjct: 31 QTYSENVFLFVPNIIGYTRVLLAALSMHYMSYHPKYCTLAYVVSCLLDAVDGQAAR 86 >KIK98857.1 hypothetical protein PAXRUDRAFT_823411 [Paxillus rubicundulus Ve08.2h10] Length = 271 Score = 97.1 bits (240), Expect = 1e-22 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPNLIGY+R+ILA +SLHFMSYHPKYCT+AY +S LLDAVDGQAAR Sbjct: 39 QTYSENVFLFVPNLIGYTRVILAGLSLHFMSYHPKYCTLAYCISCLLDAVDGQAAR 94 >KIJ16835.1 CDP-diacylglycerol---inositol 3-phosphatidyltransferase [Paxillus involutus ATCC 200175] Length = 271 Score = 97.1 bits (240), Expect = 1e-22 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPNLIGY+R+ILA +SLHFMSYHPKYCT+AY +S LLDAVDGQAAR Sbjct: 39 QTYSENVFLFVPNLIGYTRVILAGLSLHFMSYHPKYCTLAYCISCLLDAVDGQAAR 94 >KIJ68964.1 hypothetical protein HYDPIDRAFT_80498 [Hydnomerulius pinastri MD-312] Length = 278 Score = 97.1 bits (240), Expect = 2e-22 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPNLIGY+R+ILA +SLHFMSYHPKYCT+AY +S LLDAVDGQAAR Sbjct: 40 QTYSENVFLFVPNLIGYTRVILAGLSLHFMSYHPKYCTLAYCISCLLDAVDGQAAR 95 >KII88654.1 hypothetical protein PLICRDRAFT_161959 [Plicaturopsis crispa FD-325 SS-3] Length = 266 Score = 96.7 bits (239), Expect = 2e-22 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLF+PNLIGY+RIILA +SLH+MSYHPKYCT+AY VS LLDAVDGQAAR Sbjct: 31 QTYSENVFLFIPNLIGYTRIILAGLSLHYMSYHPKYCTVAYCVSCLLDAVDGQAAR 86 >XP_001874820.1 phosphatidylinositol synthase [Laccaria bicolor S238N-H82] EDR14261.1 phosphatidylinositol synthase [Laccaria bicolor S238N-H82] Length = 255 Score = 96.3 bits (238), Expect = 2e-22 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = -1 Query: 168 QRTDENVFLFVPNLIGYSRIILAAVSLHFMSYHPKYCTIAYIVSQLLDAVDGQAAR 1 Q ENVFLFVPNLIGY+R++LA +SLHFMSYHPKYCT AY+VS LLDAVDGQAAR Sbjct: 26 QTYSENVFLFVPNLIGYARVLLAGLSLHFMSYHPKYCTWAYVVSCLLDAVDGQAAR 81