BLASTX nr result
ID: Phellodendron21_contig00041027
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041027 (447 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO71397.1 hypothetical protein CISIN_1g028657mg [Citrus sinensis] 69 6e-12 KDO71398.1 hypothetical protein CISIN_1g028657mg [Citrus sinensis] 69 1e-11 XP_006425327.1 hypothetical protein CICLE_v10026500mg [Citrus cl... 67 2e-11 XP_006467037.1 PREDICTED: ganglioside-induced differentiation-as... 69 2e-11 XP_006425328.1 hypothetical protein CICLE_v10026500mg [Citrus cl... 67 3e-11 XP_006425329.1 hypothetical protein CICLE_v10026500mg [Citrus cl... 67 6e-11 XP_015889783.1 PREDICTED: ganglioside-induced differentiation-as... 64 4e-10 XP_015897872.1 PREDICTED: ganglioside-induced differentiation-as... 64 8e-10 XP_002530731.1 PREDICTED: ganglioside-induced differentiation-as... 64 1e-09 XP_007046567.2 PREDICTED: ganglioside-induced differentiation-as... 63 2e-09 OAY57624.1 hypothetical protein MANES_02G111300 [Manihot esculenta] 63 2e-09 EOX90723.1 SEC14 cytosolic factor family protein / phosphoglycer... 63 2e-09 XP_010531130.1 PREDICTED: ganglioside-induced differentiation-as... 63 2e-09 XP_013646552.1 PREDICTED: ganglioside-induced differentiation-as... 63 3e-09 ACJ85167.1 unknown [Medicago truncatula] 63 3e-09 XP_003612276.1 divergent CRAL/TRIO domain protein [Medicago trun... 63 3e-09 OAY60948.1 hypothetical protein MANES_01G152100 [Manihot esculenta] 63 3e-09 XP_018447316.1 PREDICTED: ganglioside-induced differentiation-as... 62 4e-09 JAV00592.1 Protein GDAP2 -like protein [Noccaea caerulescens] 62 6e-09 XP_009109278.1 PREDICTED: ganglioside-induced differentiation-as... 62 6e-09 >KDO71397.1 hypothetical protein CISIN_1g028657mg [Citrus sinensis] Length = 139 Score = 68.6 bits (166), Expect = 6e-12 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + S RVYPRL KK FTVLYVHTGVQRSENFAGISALRS Sbjct: 51 LKRYLSERVYPRLGKKAFTVLYVHTGVQRSENFAGISALRS 91 >KDO71398.1 hypothetical protein CISIN_1g028657mg [Citrus sinensis] Length = 168 Score = 68.6 bits (166), Expect = 1e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + S RVYPRL KK FTVLYVHTGVQRSENFAGISALRS Sbjct: 51 LKRYLSERVYPRLGKKAFTVLYVHTGVQRSENFAGISALRS 91 >XP_006425327.1 hypothetical protein CICLE_v10026500mg [Citrus clementina] ESR38567.1 hypothetical protein CICLE_v10026500mg [Citrus clementina] Length = 139 Score = 67.4 bits (163), Expect = 2e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + + RVYPRL KK FTVLYVHTGVQRSENFAGISALRS Sbjct: 51 LKRYLAERVYPRLGKKAFTVLYVHTGVQRSENFAGISALRS 91 >XP_006467037.1 PREDICTED: ganglioside-induced differentiation-associated protein 2 [Citrus sinensis] KDO71396.1 hypothetical protein CISIN_1g028657mg [Citrus sinensis] Length = 206 Score = 68.6 bits (166), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + S RVYPRL KK FTVLYVHTGVQRSENFAGISALRS Sbjct: 51 LKRYLSERVYPRLGKKAFTVLYVHTGVQRSENFAGISALRS 91 >XP_006425328.1 hypothetical protein CICLE_v10026500mg [Citrus clementina] ESR38568.1 hypothetical protein CICLE_v10026500mg [Citrus clementina] Length = 169 Score = 67.4 bits (163), Expect = 3e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + + RVYPRL KK FTVLYVHTGVQRSENFAGISALRS Sbjct: 51 LKRYLAERVYPRLGKKAFTVLYVHTGVQRSENFAGISALRS 91 >XP_006425329.1 hypothetical protein CICLE_v10026500mg [Citrus clementina] ESR38569.1 hypothetical protein CICLE_v10026500mg [Citrus clementina] Length = 206 Score = 67.4 bits (163), Expect = 6e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + + RVYPRL KK FTVLYVHTGVQRSENFAGISALRS Sbjct: 51 LKRYLAERVYPRLGKKAFTVLYVHTGVQRSENFAGISALRS 91 >XP_015889783.1 PREDICTED: ganglioside-induced differentiation-associated protein 2-like, partial [Ziziphus jujuba] Length = 163 Score = 64.3 bits (155), Expect = 4e-10 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + ++YP+L KKPF+VLYVHTGVQRSENF GISALRS Sbjct: 11 LKKYLEQKIYPKLGKKPFSVLYVHTGVQRSENFPGISALRS 51 >XP_015897872.1 PREDICTED: ganglioside-induced differentiation-associated-protein 2 [Ziziphus jujuba] Length = 202 Score = 64.3 bits (155), Expect = 8e-10 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + ++YP+L KKPF+VLYVHTGVQRSENF GISALRS Sbjct: 50 LKKYLEQKIYPKLGKKPFSVLYVHTGVQRSENFPGISALRS 90 >XP_002530731.1 PREDICTED: ganglioside-induced differentiation-associated protein 2 [Ricinus communis] EEF31637.1 conserved hypothetical protein [Ricinus communis] Length = 202 Score = 63.9 bits (154), Expect = 1e-09 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -1 Query: 153 FKISCVAWSSLSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 F + +L + ++YPRL KPF+VLYVHTGVQRSENF GISALRS Sbjct: 40 FPARIITVDALKSYLEEKIYPRLETKPFSVLYVHTGVQRSENFPGISALRS 90 >XP_007046567.2 PREDICTED: ganglioside-induced differentiation-associated protein 2 [Theobroma cacao] Length = 202 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + ++PRL KKPF+VLYVHTGVQRSENF GISALRS Sbjct: 50 LKKYLEENIFPRLGKKPFSVLYVHTGVQRSENFPGISALRS 90 >OAY57624.1 hypothetical protein MANES_02G111300 [Manihot esculenta] Length = 202 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + ++YPRL KPF+VLYVHTGVQRSENF GISALRS Sbjct: 50 LKSYLEEKIYPRLGDKPFSVLYVHTGVQRSENFPGISALRS 90 >EOX90723.1 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein isoform 1 [Theobroma cacao] EOX90724.1 G-box binding factor 3, putative isoform 1 [Theobroma cacao] Length = 202 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + ++PRL KKPF+VLYVHTGVQRSENF GISALRS Sbjct: 50 LKKYLEENIFPRLGKKPFSVLYVHTGVQRSENFPGISALRS 90 >XP_010531130.1 PREDICTED: ganglioside-induced differentiation-associated protein 2 [Tarenaya hassleriana] Length = 206 Score = 63.2 bits (152), Expect = 2e-09 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + +++PRL +KPF VLYVHTGVQRSENF GISALRS Sbjct: 54 LKTYLEEKIFPRLGRKPFAVLYVHTGVQRSENFPGISALRS 94 >XP_013646552.1 PREDICTED: ganglioside-induced differentiation-associated protein 2-like [Brassica napus] Length = 203 Score = 62.8 bits (151), Expect = 3e-09 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 LS + +++PRL +KPF VLYVHTGVQRSENF GISALR+ Sbjct: 51 LSKYLEEKIFPRLGRKPFAVLYVHTGVQRSENFPGISALRA 91 >ACJ85167.1 unknown [Medicago truncatula] Length = 203 Score = 62.8 bits (151), Expect = 3e-09 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -1 Query: 153 FKISCVAWSSLSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 F V+ L F R++P+L KK F VLY+HTGVQRSENFAGIS+LRS Sbjct: 40 FPARLVSVEVLKKFLEERIFPKLGKKKFAVLYIHTGVQRSENFAGISSLRS 90 >XP_003612276.1 divergent CRAL/TRIO domain protein [Medicago truncatula] AES95234.1 divergent CRAL/TRIO domain protein [Medicago truncatula] AFK38110.1 unknown [Medicago truncatula] Length = 203 Score = 62.8 bits (151), Expect = 3e-09 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -1 Query: 153 FKISCVAWSSLSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 F V+ L F R++P+L KK F VLY+HTGVQRSENFAGIS+LRS Sbjct: 40 FPARLVSVEVLKKFLEERIFPKLGKKKFAVLYIHTGVQRSENFAGISSLRS 90 >OAY60948.1 hypothetical protein MANES_01G152100 [Manihot esculenta] Length = 204 Score = 62.8 bits (151), Expect = 3e-09 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + ++YPRL KKPF+VLY+HTGVQRSENF ISALRS Sbjct: 50 LKSYLEEKIYPRLGKKPFSVLYIHTGVQRSENFPAISALRS 90 >XP_018447316.1 PREDICTED: ganglioside-induced differentiation-associated protein 2-like [Raphanus sativus] XP_018450401.1 PREDICTED: ganglioside-induced differentiation-associated protein 2-like [Raphanus sativus] Length = 204 Score = 62.4 bits (150), Expect = 4e-09 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = -1 Query: 153 FKISCVAWSSLSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 F V+ L + +++PRL +KPF+VLYVHTGVQRSENF GISALR+ Sbjct: 41 FPARFVSLDVLKKYLEEKIFPRLGRKPFSVLYVHTGVQRSENFPGISALRA 91 >JAV00592.1 Protein GDAP2 -like protein [Noccaea caerulescens] Length = 202 Score = 62.0 bits (149), Expect = 6e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + A+++PRL +KPF VLYVHTGVQRSENF GIS+LR+ Sbjct: 50 LKKYLDAKIFPRLGRKPFAVLYVHTGVQRSENFPGISSLRA 90 >XP_009109278.1 PREDICTED: ganglioside-induced differentiation-associated protein 2-like [Brassica rapa] Length = 202 Score = 62.0 bits (149), Expect = 6e-09 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 123 LSVFTSARVYPRLAKKPFTVLYVHTGVQRSENFAGISALRS 1 L + +++PRL +KPF++LYVHTGVQRSENF GISALR+ Sbjct: 50 LKTYLEEKIFPRLGRKPFSILYVHTGVQRSENFPGISALRA 90