BLASTX nr result
ID: Phellodendron21_contig00041014
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041014 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW15497.1 hypothetical protein TanjilG_32901 [Lupinus angustifo... 99 4e-24 KJB09734.1 hypothetical protein B456_001G161000, partial [Gossyp... 81 2e-16 YP_007516852.1 hypothetical protein GlmaxMp02 (mitochondrion) [G... 72 3e-14 OIW13576.1 hypothetical protein TanjilG_29317 [Lupinus angustifo... 67 1e-10 YP_009316009.1 hypothetical protein (mitochondrion) [Cocos nucif... 62 4e-10 >OIW15497.1 hypothetical protein TanjilG_32901 [Lupinus angustifolius] Length = 153 Score = 99.0 bits (245), Expect = 4e-24 Identities = 48/58 (82%), Positives = 49/58 (84%), Gaps = 4/58 (6%) Frame = -1 Query: 162 LIVSDSPS----GAHKIPINNLEGWLSGLRHWFAKSTYKKIVSWVRIPFPPARKWNGR 1 LI SDSPS AHKIPINNLE WLSGLRHWFAKSTY KIVSWVRIPFP A+KWNGR Sbjct: 73 LIGSDSPSVGCPTAHKIPINNLEVWLSGLRHWFAKSTYNKIVSWVRIPFPSAQKWNGR 130 >KJB09734.1 hypothetical protein B456_001G161000, partial [Gossypium raimondii] Length = 244 Score = 81.3 bits (199), Expect = 2e-16 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = +2 Query: 5 PFHFRAGGNGIRTHDTIFLYVDLANQCLKPLSHPSKLLIGI 127 P FRAGGNGIRTHDTIFLYVDLANQCLKPLSHPSKLLI I Sbjct: 204 PLDFRAGGNGIRTHDTIFLYVDLANQCLKPLSHPSKLLIEI 244 >YP_007516852.1 hypothetical protein GlmaxMp02 (mitochondrion) [Glycine max] AFR34333.1 hypothetical protein GlmaxMp02 (mitochondrion) [Glycine max] Length = 104 Score = 72.4 bits (176), Expect = 3e-14 Identities = 37/56 (66%), Positives = 39/56 (69%) Frame = +3 Query: 171 AAARVLFLYL*ARLYPDPPSIQAIQICHSLGEAFLSMKTPPLNDELCQSSPPTRPG 338 A ARVLFLY +IQICHSLG+A SM TPPLNDELCQSSPPTRPG Sbjct: 20 ALARVLFLY----------ERDSIQICHSLGDALFSMNTPPLNDELCQSSPPTRPG 65 >OIW13576.1 hypothetical protein TanjilG_29317 [Lupinus angustifolius] Length = 354 Score = 66.6 bits (161), Expect = 1e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 337 PGRVGGEDWQSSSFSGGVFIERKASPKEWQIWM 239 PGRVGGEDWQSSSFSGGVFIE++ASP EWQI M Sbjct: 318 PGRVGGEDWQSSSFSGGVFIEKRASPNEWQILM 350 >YP_009316009.1 hypothetical protein (mitochondrion) [Cocos nucifera] AOX13003.1 hypothetical protein (mitochondrion) [Cocos nucifera] Length = 112 Score = 62.0 bits (149), Expect = 4e-10 Identities = 32/41 (78%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +3 Query: 219 DPPSIQA-IQICHSLGEAFLSMKTPPLNDELCQSSPPTRPG 338 D PSIQA +QI HSLG+A LSM T PLNDEL QSSPPTRPG Sbjct: 2 DLPSIQARLQIRHSLGDALLSMNTSPLNDELSQSSPPTRPG 42