BLASTX nr result
ID: Phellodendron21_contig00041011
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00041011 (328 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO67216.1 hypothetical protein CISIN_1g008249mg [Citrus sinensis] 73 7e-13 XP_006450123.1 hypothetical protein CICLE_v10007859mg [Citrus cl... 73 7e-13 >KDO67216.1 hypothetical protein CISIN_1g008249mg [Citrus sinensis] Length = 542 Score = 73.2 bits (178), Expect = 7e-13 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 196 MALFISCGESSSPVYIHILRFLNQTFDSIKFNLARILASSRTCS 327 MALFI+CGESSSPV+I ILRFL QTFDSIK N+ARI ++SRTCS Sbjct: 1 MALFIACGESSSPVHIQILRFLYQTFDSIKLNVARIFSNSRTCS 44 >XP_006450123.1 hypothetical protein CICLE_v10007859mg [Citrus clementina] XP_006450124.1 hypothetical protein CICLE_v10007859mg [Citrus clementina] XP_006483611.1 PREDICTED: pentatricopeptide repeat-containing protein At5g24830 [Citrus sinensis] ESR63363.1 hypothetical protein CICLE_v10007859mg [Citrus clementina] ESR63364.1 hypothetical protein CICLE_v10007859mg [Citrus clementina] KDO67217.1 hypothetical protein CISIN_1g008249mg [Citrus sinensis] KDO67218.1 hypothetical protein CISIN_1g008249mg [Citrus sinensis] Length = 572 Score = 73.2 bits (178), Expect = 7e-13 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 196 MALFISCGESSSPVYIHILRFLNQTFDSIKFNLARILASSRTCS 327 MALFI+CGESSSPV+I ILRFL QTFDSIK N+ARI ++SRTCS Sbjct: 1 MALFIACGESSSPVHIQILRFLYQTFDSIKLNVARIFSNSRTCS 44