BLASTX nr result
ID: Phellodendron21_contig00040935
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040935 (481 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006466040.1 PREDICTED: uncharacterized protein LOC102608947 [... 55 4e-06 >XP_006466040.1 PREDICTED: uncharacterized protein LOC102608947 [Citrus sinensis] Length = 254 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 372 GMVVNLDEFYLGYER*LPNPLIVEKLRSIFNAASLA 479 G+V NLDE Y+GYER LPNP VEK RS+FNAASLA Sbjct: 88 GVVANLDESYMGYERWLPNPPKVEKPRSVFNAASLA 123