BLASTX nr result
ID: Phellodendron21_contig00040847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040847 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007403549.1 family 57 glycosyltransferase [Melampsora larici-... 74 7e-13 >XP_007403549.1 family 57 glycosyltransferase [Melampsora larici-populina 98AG31] EGG12611.1 family 57 glycosyltransferase [Melampsora larici-populina 98AG31] Length = 1054 Score = 73.9 bits (180), Expect = 7e-13 Identities = 45/80 (56%), Positives = 47/80 (58%), Gaps = 26/80 (32%) Frame = -1 Query: 303 KLEVVEQDWETALRHSREGAIRRRREELR--------------SGAKGIHS--------- 193 K+EVVEQDWE ALR SREGAIRRRREELR G G S Sbjct: 975 KIEVVEQDWEMALRQSREGAIRRRREELRLQANLANASVTGGTGGGAGGGSRKLSMSMNM 1034 Query: 192 ---GGYVDAVDLVNGPPSRR 142 GGYVDA+DLVNGPPSRR Sbjct: 1035 NLVGGYVDALDLVNGPPSRR 1054