BLASTX nr result
ID: Phellodendron21_contig00040720
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040720 (288 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO64602.1 hypothetical protein CISIN_1g019863mg [Citrus sinensis] 57 1e-07 KDO64601.1 hypothetical protein CISIN_1g019863mg [Citrus sinensis] 57 1e-07 KDO64600.1 hypothetical protein CISIN_1g019863mg [Citrus sinensis] 57 2e-07 XP_006469202.1 PREDICTED: protein BCCIP homolog isoform X3 [Citr... 57 2e-07 KDO64599.1 hypothetical protein CISIN_1g019863mg [Citrus sinensis] 57 2e-07 XP_006469201.1 PREDICTED: protein BCCIP homolog isoform X2 [Citr... 57 2e-07 KDO64598.1 hypothetical protein CISIN_1g019863mg [Citrus sinensis] 57 2e-07 XP_006469196.1 PREDICTED: protein BCCIP homolog isoform X1 [Citr... 57 2e-07 KDO57866.1 hypothetical protein CISIN_1g023271mg [Citrus sinensis] 55 3e-07 XP_006422850.1 hypothetical protein CICLE_v10028815mg [Citrus cl... 55 5e-07 KDO57865.1 hypothetical protein CISIN_1g023271mg [Citrus sinensis] 55 5e-07 XP_006422849.1 hypothetical protein CICLE_v10028815mg [Citrus cl... 55 5e-07 KDO57863.1 hypothetical protein CISIN_1g023271mg [Citrus sinensis] 55 6e-07 KDO57862.1 hypothetical protein CISIN_1g023271mg [Citrus sinensis] 55 6e-07 KDO57864.1 hypothetical protein CISIN_1g023271mg [Citrus sinensis] 55 6e-07 XP_015388357.1 PREDICTED: protein BCCIP homolog isoform X5 [Citr... 55 6e-07 XP_015388356.1 PREDICTED: protein BCCIP homolog isoform X4 [Citr... 55 6e-07 XP_015388355.1 PREDICTED: protein BCCIP homolog isoform X3 [Citr... 55 6e-07 XP_015388354.1 PREDICTED: protein BCCIP homolog isoform X2 [Citr... 55 6e-07 XP_015388353.1 PREDICTED: protein BCCIP homolog isoform X1 [Citr... 55 6e-07 >KDO64602.1 hypothetical protein CISIN_1g019863mg [Citrus sinensis] Length = 252 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+DAQWDLSG Sbjct: 17 FVFFDPKPDDFHGVKILLQTYLDDAQWDLSG 47 >KDO64601.1 hypothetical protein CISIN_1g019863mg [Citrus sinensis] Length = 266 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+DAQWDLSG Sbjct: 17 FVFFDPKPDDFHGVKILLQTYLDDAQWDLSG 47 >KDO64600.1 hypothetical protein CISIN_1g019863mg [Citrus sinensis] Length = 290 Score = 57.0 bits (136), Expect = 2e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+DAQWDLSG Sbjct: 85 FVFFDPKPDDFHGVKILLQTYLDDAQWDLSG 115 >XP_006469202.1 PREDICTED: protein BCCIP homolog isoform X3 [Citrus sinensis] Length = 290 Score = 57.0 bits (136), Expect = 2e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+DAQWDLSG Sbjct: 41 FVFFDPKPDDFHGVKILLQTYLDDAQWDLSG 71 >KDO64599.1 hypothetical protein CISIN_1g019863mg [Citrus sinensis] Length = 320 Score = 57.0 bits (136), Expect = 2e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+DAQWDLSG Sbjct: 85 FVFFDPKPDDFHGVKILLQTYLDDAQWDLSG 115 >XP_006469201.1 PREDICTED: protein BCCIP homolog isoform X2 [Citrus sinensis] Length = 332 Score = 57.0 bits (136), Expect = 2e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+DAQWDLSG Sbjct: 85 FVFFDPKPDDFHGVKILLQTYLDDAQWDLSG 115 >KDO64598.1 hypothetical protein CISIN_1g019863mg [Citrus sinensis] Length = 334 Score = 57.0 bits (136), Expect = 2e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+DAQWDLSG Sbjct: 85 FVFFDPKPDDFHGVKILLQTYLDDAQWDLSG 115 >XP_006469196.1 PREDICTED: protein BCCIP homolog isoform X1 [Citrus sinensis] XP_006469197.1 PREDICTED: protein BCCIP homolog isoform X1 [Citrus sinensis] XP_006469198.1 PREDICTED: protein BCCIP homolog isoform X1 [Citrus sinensis] XP_006469199.1 PREDICTED: protein BCCIP homolog isoform X1 [Citrus sinensis] XP_006469200.1 PREDICTED: protein BCCIP homolog isoform X1 [Citrus sinensis] Length = 334 Score = 57.0 bits (136), Expect = 2e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+DAQWDLSG Sbjct: 85 FVFFDPKPDDFHGVKILLQTYLDDAQWDLSG 115 >KDO57866.1 hypothetical protein CISIN_1g023271mg [Citrus sinensis] Length = 198 Score = 55.5 bits (132), Expect = 3e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+D QWDLSG Sbjct: 58 FVFFDPKPDDFHGVKILLQTYLDDTQWDLSG 88 >XP_006422850.1 hypothetical protein CICLE_v10028815mg [Citrus clementina] ESR36090.1 hypothetical protein CICLE_v10028815mg [Citrus clementina] Length = 243 Score = 55.5 bits (132), Expect = 5e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+D QWDLSG Sbjct: 58 FVFFDPKPDDFHGVKILLQTYLDDTQWDLSG 88 >KDO57865.1 hypothetical protein CISIN_1g023271mg [Citrus sinensis] Length = 262 Score = 55.5 bits (132), Expect = 5e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+D QWDLSG Sbjct: 58 FVFFDPKPDDFHGVKILLQTYLDDTQWDLSG 88 >XP_006422849.1 hypothetical protein CICLE_v10028815mg [Citrus clementina] ESR36089.1 hypothetical protein CICLE_v10028815mg [Citrus clementina] Length = 270 Score = 55.5 bits (132), Expect = 5e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+D QWDLSG Sbjct: 85 FVFFDPKPDDFHGVKILLQTYLDDTQWDLSG 115 >KDO57863.1 hypothetical protein CISIN_1g023271mg [Citrus sinensis] Length = 278 Score = 55.5 bits (132), Expect = 6e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+D QWDLSG Sbjct: 58 FVFFDPKPDDFHGVKILLQTYLDDTQWDLSG 88 >KDO57862.1 hypothetical protein CISIN_1g023271mg [Citrus sinensis] Length = 280 Score = 55.5 bits (132), Expect = 6e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+D QWDLSG Sbjct: 54 FVFFDPKPDDFHGVKILLQTYLDDTQWDLSG 84 >KDO57864.1 hypothetical protein CISIN_1g023271mg [Citrus sinensis] Length = 284 Score = 55.5 bits (132), Expect = 6e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+D QWDLSG Sbjct: 58 FVFFDPKPDDFHGVKILLQTYLDDTQWDLSG 88 >XP_015388357.1 PREDICTED: protein BCCIP homolog isoform X5 [Citrus sinensis] Length = 295 Score = 55.5 bits (132), Expect = 6e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+D QWDLSG Sbjct: 85 FVFFDPKPDDFHGVKILLQTYLDDTQWDLSG 115 >XP_015388356.1 PREDICTED: protein BCCIP homolog isoform X4 [Citrus sinensis] Length = 301 Score = 55.5 bits (132), Expect = 6e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+D QWDLSG Sbjct: 85 FVFFDPKPDDFHGVKILLQTYLDDTQWDLSG 115 >XP_015388355.1 PREDICTED: protein BCCIP homolog isoform X3 [Citrus sinensis] Length = 305 Score = 55.5 bits (132), Expect = 6e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+D QWDLSG Sbjct: 85 FVFFDPKPDDFHGVKILLQTYLDDTQWDLSG 115 >XP_015388354.1 PREDICTED: protein BCCIP homolog isoform X2 [Citrus sinensis] Length = 307 Score = 55.5 bits (132), Expect = 6e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+D QWDLSG Sbjct: 81 FVFFDPKPDDFHGVKILLQTYLDDTQWDLSG 111 >XP_015388353.1 PREDICTED: protein BCCIP homolog isoform X1 [Citrus sinensis] Length = 311 Score = 55.5 bits (132), Expect = 6e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 194 FFLFDPKPDDFC*VKILLQTYLNDAQWDLSG 286 F FDPKPDDF VKILLQTYL+D QWDLSG Sbjct: 85 FVFFDPKPDDFHGVKILLQTYLDDTQWDLSG 115