BLASTX nr result
ID: Phellodendron21_contig00040706
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040706 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006470705.1 PREDICTED: DDT domain-containing protein PTM [Cit... 48 5e-09 XP_006446212.1 hypothetical protein CICLE_v10014020mg [Citrus cl... 48 5e-09 XP_006446213.1 hypothetical protein CICLE_v10014020mg [Citrus cl... 48 5e-09 KDO50418.1 hypothetical protein CISIN_1g000462mg [Citrus sinensis] 48 5e-09 KDO50419.1 hypothetical protein CISIN_1g000462mg [Citrus sinensis] 48 5e-09 >XP_006470705.1 PREDICTED: DDT domain-containing protein PTM [Citrus sinensis] Length = 1761 Score = 48.1 bits (113), Expect(3) = 5e-09 Identities = 24/39 (61%), Positives = 29/39 (74%), Gaps = 5/39 (12%) Frame = -1 Query: 127 AERVEEPVANPPN----PASQNLDLDGIPLLDVF-FYLC 26 A R+EEPV NPP P+S+NLDLDGIP+LD+F Y C Sbjct: 389 AGRIEEPVVNPPKLLLPPSSRNLDLDGIPVLDLFSIYAC 427 Score = 34.7 bits (78), Expect(3) = 5e-09 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 215 VSSKTSCEVNDLPYSMADASMEELLVTL 132 +SSK SCEVND +MAD SMEEL TL Sbjct: 363 LSSKMSCEVND---AMADVSMEELPATL 387 Score = 24.3 bits (51), Expect(3) = 5e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 39 FSIYVFLRSFSTL 1 FSIY LRSFSTL Sbjct: 422 FSIYACLRSFSTL 434 >XP_006446212.1 hypothetical protein CICLE_v10014020mg [Citrus clementina] ESR59452.1 hypothetical protein CICLE_v10014020mg [Citrus clementina] Length = 1761 Score = 48.1 bits (113), Expect(3) = 5e-09 Identities = 24/39 (61%), Positives = 29/39 (74%), Gaps = 5/39 (12%) Frame = -1 Query: 127 AERVEEPVANPPN----PASQNLDLDGIPLLDVF-FYLC 26 A R+EEPV NPP P+S+NLDLDGIP+LD+F Y C Sbjct: 389 AGRIEEPVVNPPKLLLPPSSRNLDLDGIPVLDLFSIYAC 427 Score = 34.7 bits (78), Expect(3) = 5e-09 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 215 VSSKTSCEVNDLPYSMADASMEELLVTL 132 +SSK SCEVND +MAD SMEEL TL Sbjct: 363 LSSKMSCEVND---AMADVSMEELPATL 387 Score = 24.3 bits (51), Expect(3) = 5e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 39 FSIYVFLRSFSTL 1 FSIY LRSFSTL Sbjct: 422 FSIYACLRSFSTL 434 >XP_006446213.1 hypothetical protein CICLE_v10014020mg [Citrus clementina] ESR59453.1 hypothetical protein CICLE_v10014020mg [Citrus clementina] Length = 1579 Score = 48.1 bits (113), Expect(3) = 5e-09 Identities = 24/39 (61%), Positives = 29/39 (74%), Gaps = 5/39 (12%) Frame = -1 Query: 127 AERVEEPVANPPN----PASQNLDLDGIPLLDVF-FYLC 26 A R+EEPV NPP P+S+NLDLDGIP+LD+F Y C Sbjct: 389 AGRIEEPVVNPPKLLLPPSSRNLDLDGIPVLDLFSIYAC 427 Score = 34.7 bits (78), Expect(3) = 5e-09 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 215 VSSKTSCEVNDLPYSMADASMEELLVTL 132 +SSK SCEVND +MAD SMEEL TL Sbjct: 363 LSSKMSCEVND---AMADVSMEELPATL 387 Score = 24.3 bits (51), Expect(3) = 5e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 39 FSIYVFLRSFSTL 1 FSIY LRSFSTL Sbjct: 422 FSIYACLRSFSTL 434 >KDO50418.1 hypothetical protein CISIN_1g000462mg [Citrus sinensis] Length = 1482 Score = 48.1 bits (113), Expect(3) = 5e-09 Identities = 24/39 (61%), Positives = 29/39 (74%), Gaps = 5/39 (12%) Frame = -1 Query: 127 AERVEEPVANPPN----PASQNLDLDGIPLLDVF-FYLC 26 A R+EEPV NPP P+S+NLDLDGIP+LD+F Y C Sbjct: 110 AGRIEEPVVNPPKLLLPPSSRNLDLDGIPVLDLFSIYAC 148 Score = 34.7 bits (78), Expect(3) = 5e-09 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 215 VSSKTSCEVNDLPYSMADASMEELLVTL 132 +SSK SCEVND +MAD SMEEL TL Sbjct: 84 LSSKISCEVND---AMADVSMEELPATL 108 Score = 24.3 bits (51), Expect(3) = 5e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 39 FSIYVFLRSFSTL 1 FSIY LRSFSTL Sbjct: 143 FSIYACLRSFSTL 155 >KDO50419.1 hypothetical protein CISIN_1g000462mg [Citrus sinensis] Length = 1306 Score = 48.1 bits (113), Expect(3) = 5e-09 Identities = 24/39 (61%), Positives = 29/39 (74%), Gaps = 5/39 (12%) Frame = -1 Query: 127 AERVEEPVANPPN----PASQNLDLDGIPLLDVF-FYLC 26 A R+EEPV NPP P+S+NLDLDGIP+LD+F Y C Sbjct: 110 AGRIEEPVVNPPKLLLPPSSRNLDLDGIPVLDLFSIYAC 148 Score = 34.7 bits (78), Expect(3) = 5e-09 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 215 VSSKTSCEVNDLPYSMADASMEELLVTL 132 +SSK SCEVND +MAD SMEEL TL Sbjct: 84 LSSKISCEVND---AMADVSMEELPATL 108 Score = 24.3 bits (51), Expect(3) = 5e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 39 FSIYVFLRSFSTL 1 FSIY LRSFSTL Sbjct: 143 FSIYACLRSFSTL 155