BLASTX nr result
ID: Phellodendron21_contig00040639
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040639 (309 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016271042.1 60S ribosomal protein l36 [Rhodotorula toruloides... 104 3e-27 GAA96049.1 hypothetical protein E5Q_02710 [Mixia osmundae IAM 14... 104 4e-27 XP_018268415.1 hypothetical protein RHOBADRAFT_46816 [Rhodotorul... 103 6e-27 KDE02275.1 50S ribosomal protein L36e [Microbotryum lychnidis-di... 103 1e-26 KNF00337.1 50S ribosomal protein L36e [Puccinia striiformis f. s... 103 2e-26 XP_003307107.1 60S ribosomal protein L36 [Puccinia graminis f. s... 102 3e-26 XP_007415443.1 hypothetical protein MELLADRAFT_50142 [Melampsora... 102 5e-26 KWU43509.1 60S ribosomal protein l36 [Rhodotorula sp. JG-1b] 100 2e-25 CCX05046.1 Similar to 60S ribosomal protein L36; acc. no. Q9HFR7... 99 6e-25 KXS13505.1 ribosomal protein L36e [Gonapodya prolifera JEL478] 99 1e-24 EPZ34903.1 60S ribosomal protein L36-B [Rozella allomycis CSF55] 97 5e-24 CZT42795.1 probable 60S ribosomal protein L36 [Rhynchosporium se... 96 8e-24 OCT45920.1 60S ribosomal protein L36 [Cladophialophora carrionii] 96 8e-24 XP_007753968.1 60S ribosomal protein L36 [Cladophialophora yegre... 96 8e-24 KIV77938.1 60S ribosomal protein L36 [Exophiala sideris] 96 1e-23 EWC46294.1 60S ribosomal protein L36 [Drechslerella stenobrocha ... 96 1e-23 KEQ85116.1 ribosomal protein L36e [Aureobasidium pullulans EXF-150] 96 2e-23 XP_006678782.1 hypothetical protein BATDEDRAFT_88084 [Batrachoch... 96 2e-23 KFH65734.1 50S ribosomal protein L36e [Mortierella verticillata ... 95 2e-23 KFH65383.1 50S ribosomal protein L36e [Mortierella verticillata ... 95 2e-23 >XP_016271042.1 60S ribosomal protein l36 [Rhodotorula toruloides NP11] EMS19923.1 60S ribosomal protein l36 [Rhodotorula toruloides NP11] CDR44572.1 RHTO0S09e06458g1_1 [Rhodotorula toruloides] Length = 102 Score = 104 bits (260), Expect = 3e-27 Identities = 51/70 (72%), Positives = 60/70 (85%) Frame = -2 Query: 308 KAGARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELT 129 K AR FVK+++REVAG APYERR+MEL+RN +DKKAR+ K+RLGTLRRAKRKVDELT Sbjct: 32 KQSARSAFVKSVVREVAGFAPYERRVMELIRNSKDKKARKLTKKRLGTLRRAKRKVDELT 91 Query: 128 NIIAEQRRTA 99 +IAEQRR A Sbjct: 92 GVIAEQRRHA 101 >GAA96049.1 hypothetical protein E5Q_02710 [Mixia osmundae IAM 14324] Length = 106 Score = 104 bits (260), Expect = 4e-27 Identities = 48/71 (67%), Positives = 61/71 (85%) Frame = -2 Query: 308 KAGARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELT 129 KA R +FV++++R+VAG APYERR+MEL+RN +DKKAR+ K++LGTLRRAKRKVDELT Sbjct: 36 KASKRSIFVRSVVRDVAGYAPYERRVMELIRNSKDKKARKLTKRKLGTLRRAKRKVDELT 95 Query: 128 NIIAEQRRTAH 96 +IAEQRR H Sbjct: 96 GVIAEQRRGGH 106 >XP_018268415.1 hypothetical protein RHOBADRAFT_46816 [Rhodotorula graminis WP1] KPV72366.1 hypothetical protein RHOBADRAFT_46816 [Rhodotorula graminis WP1] Length = 103 Score = 103 bits (258), Expect = 6e-27 Identities = 51/70 (72%), Positives = 60/70 (85%) Frame = -2 Query: 308 KAGARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELT 129 + AR FVK+I+REVAG APYERR+MEL+RN +DKKAR+ K+RLGTLRRAKRKVDELT Sbjct: 33 RQSARSAFVKSIVREVAGFAPYERRVMELIRNSKDKKARKLTKKRLGTLRRAKRKVDELT 92 Query: 128 NIIAEQRRTA 99 +IAEQRR A Sbjct: 93 GVIAEQRRHA 102 >KDE02275.1 50S ribosomal protein L36e [Microbotryum lychnidis-dioicae p1A1 Lamole] Length = 104 Score = 103 bits (256), Expect = 1e-26 Identities = 51/70 (72%), Positives = 60/70 (85%) Frame = -2 Query: 308 KAGARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELT 129 K R+ FVK+I+REVAG APYERR+MEL+RN +DKKAR+ K+RLGTLRRAKRKVDELT Sbjct: 34 KQSNRQAFVKSIVREVAGFAPYERRVMELIRNSKDKKARKLTKKRLGTLRRAKRKVDELT 93 Query: 128 NIIAEQRRTA 99 +IAEQRR A Sbjct: 94 GVIAEQRRHA 103 >KNF00337.1 50S ribosomal protein L36e [Puccinia striiformis f. sp. tritici PST-78] Length = 111 Score = 103 bits (256), Expect = 2e-26 Identities = 50/71 (70%), Positives = 59/71 (83%) Frame = -2 Query: 308 KAGARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELT 129 +A R FV++I+REVAG APYERR+MELLRN +DKKAR+ K+RLGTLRRAKRKVDELT Sbjct: 41 RASKRTTFVRSIVREVAGFAPYERRVMELLRNSKDKKARKLTKRRLGTLRRAKRKVDELT 100 Query: 128 NIIAEQRRTAH 96 +IAE RR H Sbjct: 101 GVIAETRRAGH 111 >XP_003307107.1 60S ribosomal protein L36 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP74101.1 50S ribosomal protein L36e [Puccinia graminis f. sp. tritici CRL 75-36-700-3] OAV91909.1 50S ribosomal protein L36e [Puccinia triticina 1-1 BBBD Race 1] Length = 111 Score = 102 bits (254), Expect = 3e-26 Identities = 49/71 (69%), Positives = 59/71 (83%) Frame = -2 Query: 308 KAGARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELT 129 +A R FV++I+REVAG APYERR+MEL+RN +DKKAR+ K+RLGTLRRAKRKVDELT Sbjct: 41 RASKRTTFVRSIVREVAGFAPYERRVMELIRNSKDKKARKLTKRRLGTLRRAKRKVDELT 100 Query: 128 NIIAEQRRTAH 96 +IAE RR H Sbjct: 101 GVIAETRRAGH 111 >XP_007415443.1 hypothetical protein MELLADRAFT_50142 [Melampsora larici-populina 98AG31] EGG01342.1 hypothetical protein MELLADRAFT_50142 [Melampsora larici-populina 98AG31] Length = 111 Score = 102 bits (253), Expect = 5e-26 Identities = 49/70 (70%), Positives = 58/70 (82%) Frame = -2 Query: 305 AGARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELTN 126 A R FV++I+REVAG APYERR+MEL+RN +DKKAR+ K+RLGTLRRAKRKVDELT Sbjct: 42 ASKRTTFVRSIVREVAGFAPYERRVMELIRNSKDKKARKLTKRRLGTLRRAKRKVDELTG 101 Query: 125 IIAEQRRTAH 96 +IAE RR H Sbjct: 102 VIAESRRAGH 111 >KWU43509.1 60S ribosomal protein l36 [Rhodotorula sp. JG-1b] Length = 103 Score = 100 bits (249), Expect = 2e-25 Identities = 49/68 (72%), Positives = 57/68 (83%) Frame = -2 Query: 308 KAGARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELT 129 K R FVK+I+REV G APYERR+MEL+RN +DKKAR+ K+RLGTLRRAKRKVDELT Sbjct: 33 KQSQRAAFVKSIVREVVGFAPYERRVMELIRNSKDKKARKLTKKRLGTLRRAKRKVDELT 92 Query: 128 NIIAEQRR 105 +IAEQRR Sbjct: 93 GVIAEQRR 100 >CCX05046.1 Similar to 60S ribosomal protein L36; acc. no. Q9HFR7 [Pyronema omphalodes CBS 100304] Length = 104 Score = 99.0 bits (245), Expect = 6e-25 Identities = 47/71 (66%), Positives = 59/71 (83%) Frame = -2 Query: 308 KAGARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELT 129 +A R FV+ I++EVAG +PYERR++ELLRN +DK+AR+ AK+RLGT RAKRKVDELT Sbjct: 34 QASKRTTFVREIVKEVAGLSPYERRVIELLRNSKDKRARKLAKKRLGTYGRAKRKVDELT 93 Query: 128 NIIAEQRRTAH 96 N+IAE RR AH Sbjct: 94 NVIAESRRAAH 104 >KXS13505.1 ribosomal protein L36e [Gonapodya prolifera JEL478] Length = 115 Score = 98.6 bits (244), Expect = 1e-24 Identities = 49/66 (74%), Positives = 59/66 (89%) Frame = -2 Query: 296 RKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELTNIIA 117 R V+++IREVAG APYERR+MELLRN +DK+AR+ AK+RLGTL RAKRKV+EL+NIIA Sbjct: 48 RSKLVRDLIREVAGFAPYERRVMELLRNAKDKRARKLAKKRLGTLTRAKRKVEELSNIIA 107 Query: 116 EQRRTA 99 EQRRTA Sbjct: 108 EQRRTA 113 >EPZ34903.1 60S ribosomal protein L36-B [Rozella allomycis CSF55] Length = 105 Score = 96.7 bits (239), Expect = 5e-24 Identities = 45/68 (66%), Positives = 57/68 (83%) Frame = -2 Query: 302 GARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELTNI 123 G R FV+ +IREVAG APYE+R+MELL+NG+DK+AR+ K+RLGTLRRAKRK++EL N+ Sbjct: 36 GKRTQFVRGLIREVAGFAPYEKRIMELLKNGRDKRARKLTKRRLGTLRRAKRKIEELNNV 95 Query: 122 IAEQRRTA 99 I E RR A Sbjct: 96 IVESRRAA 103 >CZT42795.1 probable 60S ribosomal protein L36 [Rhynchosporium secalis] CZS94373.1 probable 60S ribosomal protein L36 [Rhynchosporium agropyri] CZT09783.1 probable 60S ribosomal protein L36 [Rhynchosporium commune] Length = 106 Score = 96.3 bits (238), Expect = 8e-24 Identities = 46/71 (64%), Positives = 58/71 (81%) Frame = -2 Query: 308 KAGARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELT 129 KA R FV+ I++EV+G APYERR++ELLRN +DK+AR+ AK+RLGT RAK KV+ELT Sbjct: 36 KASKRTQFVREIVKEVSGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRAKAKVEELT 95 Query: 128 NIIAEQRRTAH 96 N+IAE RR AH Sbjct: 96 NVIAESRRAAH 106 >OCT45920.1 60S ribosomal protein L36 [Cladophialophora carrionii] Length = 106 Score = 96.3 bits (238), Expect = 8e-24 Identities = 46/67 (68%), Positives = 56/67 (83%) Frame = -2 Query: 296 RKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELTNIIA 117 R FV+ I++EVAG APYERR++ELLRN +DK+AR+ AK+RLGT RAKRKVDELT +IA Sbjct: 40 RTAFVREIVKEVAGLAPYERRVIELLRNSKDKRARKLAKKRLGTYGRAKRKVDELTRVIA 99 Query: 116 EQRRTAH 96 E RRT H Sbjct: 100 EARRTGH 106 >XP_007753968.1 60S ribosomal protein L36 [Cladophialophora yegresii CBS 114405] EXJ65401.1 60S ribosomal protein L36 [Cladophialophora yegresii CBS 114405] Length = 106 Score = 96.3 bits (238), Expect = 8e-24 Identities = 46/67 (68%), Positives = 56/67 (83%) Frame = -2 Query: 296 RKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELTNIIA 117 R FV+ I++EVAG APYERR++ELLRN +DK+AR+ AK+RLGT RAKRKVDELT +IA Sbjct: 40 RTAFVREIVKEVAGLAPYERRVIELLRNSKDKRARKLAKKRLGTYGRAKRKVDELTRVIA 99 Query: 116 EQRRTAH 96 E RRT H Sbjct: 100 EARRTGH 106 >KIV77938.1 60S ribosomal protein L36 [Exophiala sideris] Length = 106 Score = 95.9 bits (237), Expect = 1e-23 Identities = 46/67 (68%), Positives = 56/67 (83%) Frame = -2 Query: 296 RKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELTNIIA 117 R FV+ I+REVAG APYERR++ELLRN +DK+AR+ AK+RLGTL RAKRKVD+L +IA Sbjct: 40 RTAFVREIVREVAGLAPYERRVIELLRNSKDKRARKLAKKRLGTLGRAKRKVDDLQRVIA 99 Query: 116 EQRRTAH 96 E RRT H Sbjct: 100 EARRTGH 106 >EWC46294.1 60S ribosomal protein L36 [Drechslerella stenobrocha 248] Length = 103 Score = 95.5 bits (236), Expect = 1e-23 Identities = 44/71 (61%), Positives = 58/71 (81%) Frame = -2 Query: 308 KAGARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELT 129 K+ R +FV+ I++EVAG APYE+R++EL+RN +DK+AR+ AK+RLGT RAKRKVDELT Sbjct: 33 KSSKRTLFVREIVKEVAGLAPYEKRVIELIRNSKDKRARKLAKKRLGTFGRAKRKVDELT 92 Query: 128 NIIAEQRRTAH 96 +IAE RR H Sbjct: 93 RVIAESRRAGH 103 >KEQ85116.1 ribosomal protein L36e [Aureobasidium pullulans EXF-150] Length = 106 Score = 95.5 bits (236), Expect = 2e-23 Identities = 45/67 (67%), Positives = 56/67 (83%) Frame = -2 Query: 296 RKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELTNIIA 117 R FV++I++EVAG APYERR++ELLRN +DK+AR+ AK+RLGT RAKRKVDE+TN IA Sbjct: 40 RTAFVRDIVKEVAGLAPYERRVVELLRNSKDKRARKLAKRRLGTFGRAKRKVDEMTNYIA 99 Query: 116 EQRRTAH 96 E RR H Sbjct: 100 ESRRAGH 106 >XP_006678782.1 hypothetical protein BATDEDRAFT_88084 [Batrachochytrium dendrobatidis JAM81] EGF81011.1 hypothetical protein BATDEDRAFT_88084 [Batrachochytrium dendrobatidis JAM81] OAJ41856.1 ribosomal protein L36e [Batrachochytrium dendrobatidis JEL423] Length = 112 Score = 95.5 bits (236), Expect = 2e-23 Identities = 44/68 (64%), Positives = 59/68 (86%) Frame = -2 Query: 302 GARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELTNI 123 G R FV++++REV G +PYE+R+MELL+N +DK+AR+ AK+RLGTLRRAKRKV+EL+N+ Sbjct: 41 GKRTKFVRDLVREVVGFSPYEKRVMELLKNSKDKRARKVAKKRLGTLRRAKRKVEELSNV 100 Query: 122 IAEQRRTA 99 IAE RR A Sbjct: 101 IAESRRAA 108 >KFH65734.1 50S ribosomal protein L36e [Mortierella verticillata NRRL 6337] Length = 102 Score = 95.1 bits (235), Expect = 2e-23 Identities = 45/67 (67%), Positives = 59/67 (88%) Frame = -2 Query: 305 AGARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELTN 126 AG R VFV++IIREVAG APYERR+MEL++N +DK+AR+ AK+RLGT RAK+KV+E+T+ Sbjct: 34 AGKRVVFVRSIIREVAGFAPYERRIMELIKNSKDKRARKLAKKRLGTFLRAKKKVEEMTS 93 Query: 125 IIAEQRR 105 +IAE RR Sbjct: 94 VIAESRR 100 >KFH65383.1 50S ribosomal protein L36e [Mortierella verticillata NRRL 6337] Length = 102 Score = 95.1 bits (235), Expect = 2e-23 Identities = 45/67 (67%), Positives = 59/67 (88%) Frame = -2 Query: 305 AGARKVFVKNIIREVAGQAPYERRLMELLRNGQDKKARRTAKQRLGTLRRAKRKVDELTN 126 AG R VFV++IIREVAG APYERR+MEL++N +DK+AR+ AK+RLGT RAK+KV+E+T+ Sbjct: 34 AGKRVVFVRSIIREVAGFAPYERRIMELIKNSKDKRARKLAKKRLGTFLRAKKKVEEMTS 93 Query: 125 IIAEQRR 105 +IAE RR Sbjct: 94 VIAESRR 100