BLASTX nr result
ID: Phellodendron21_contig00040615
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040615 (503 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO75275.1 hypothetical protein CISIN_1g033257mg [Citrus sinensis] 60 1e-10 XP_019227520.1 PREDICTED: kxDL motif-containing protein 1 [Nicot... 54 2e-10 XP_016447834.1 PREDICTED: kxDL motif-containing protein CG10681-... 54 2e-10 XP_011008283.1 PREDICTED: kxDL motif-containing protein 1 [Popul... 54 2e-10 XP_009759706.1 PREDICTED: kxDL motif-containing protein 1 [Nicot... 54 2e-10 XP_009616275.1 PREDICTED: kxDL motif-containing protein 1 [Nicot... 54 2e-10 XP_011096677.1 PREDICTED: kxDL motif-containing protein 1 [Sesam... 55 4e-10 KCW48216.1 hypothetical protein EUGRSUZ_K01942, partial [Eucalyp... 53 6e-10 XP_017639538.1 PREDICTED: kxDL motif-containing protein 1 [Gossy... 54 6e-10 XP_012450321.1 PREDICTED: kxDL motif-containing protein 1 [Gossy... 54 6e-10 XP_010036602.1 PREDICTED: kxDL motif-containing protein 1 [Eucal... 53 6e-10 XP_006377666.1 hypothetical protein POPTR_0011s10060g [Populus t... 53 6e-10 CAN60705.1 hypothetical protein VITISV_025178 [Vitis vinifera] 53 7e-10 EYU19127.1 hypothetical protein MIMGU_mgv1a015940mg [Erythranthe... 54 8e-10 XP_012827445.1 PREDICTED: kxDL motif-containing protein 1-like [... 54 8e-10 XP_012827422.1 PREDICTED: kxDL motif-containing protein 1-like [... 54 8e-10 XP_012846856.1 PREDICTED: kxDL motif-containing protein 1-like i... 54 8e-10 EYU19126.1 hypothetical protein MIMGU_mgv1a015940mg [Erythranthe... 54 8e-10 XP_016559369.1 PREDICTED: kxDL motif-containing protein 1 [Capsi... 52 8e-10 CDP17315.1 unnamed protein product [Coffea canephora] 52 8e-10 >KDO75275.1 hypothetical protein CISIN_1g033257mg [Citrus sinensis] Length = 110 Score = 59.7 bits (143), Expect(2) = 1e-10 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 186 CRLGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 CRLGRLQD+N V+SHF+EY ENC +VA DFSRN Sbjct: 25 CRLGRLQDSNAVMSHFNEYSENCFAEVAGDFSRN 58 Score = 33.5 bits (75), Expect(2) = 1e-10 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F + LLKSM DLDYIFQKLR Sbjct: 55 FSRNTRLLKSMTLDLDYIFQKLR 77 >XP_019227520.1 PREDICTED: kxDL motif-containing protein 1 [Nicotiana attenuata] XP_019227526.1 PREDICTED: kxDL motif-containing protein 1 [Nicotiana attenuata] XP_019227531.1 PREDICTED: kxDL motif-containing protein 1 [Nicotiana attenuata] OIT06152.1 hypothetical protein A4A49_29531 [Nicotiana attenuata] Length = 123 Score = 54.3 bits (129), Expect(2) = 2e-10 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF+EY E+C T+V++DFSRN Sbjct: 40 LGRLQDSNAVLSHFNEYSEHCFTEVSADFSRN 71 Score = 38.1 bits (87), Expect(2) = 2e-10 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F + LLKSMKSDLDYIFQKLR Sbjct: 68 FSRNTRLLKSMKSDLDYIFQKLR 90 >XP_016447834.1 PREDICTED: kxDL motif-containing protein CG10681-like, partial [Nicotiana tabacum] Length = 103 Score = 54.3 bits (129), Expect(2) = 2e-10 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF+EY E+C T+V++DFSRN Sbjct: 40 LGRLQDSNAVLSHFNEYSEHCFTEVSADFSRN 71 Score = 38.1 bits (87), Expect(2) = 2e-10 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F + LLKSMKSDLDYIFQKLR Sbjct: 68 FSRNTRLLKSMKSDLDYIFQKLR 90 >XP_011008283.1 PREDICTED: kxDL motif-containing protein 1 [Populus euphratica] XP_011008284.1 PREDICTED: kxDL motif-containing protein 1 [Populus euphratica] XP_011008285.1 PREDICTED: kxDL motif-containing protein 1 [Populus euphratica] XP_011008288.1 PREDICTED: kxDL motif-containing protein 1 [Populus euphratica] Length = 119 Score = 54.3 bits (129), Expect(2) = 2e-10 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF+EY ENC +V++DFSRN Sbjct: 37 LGRLQDSNAVLSHFNEYSENCFAEVSADFSRN 68 Score = 38.1 bits (87), Expect(2) = 2e-10 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F + LLKSMKSDLDYIFQKLR Sbjct: 65 FSRNTRLLKSMKSDLDYIFQKLR 87 >XP_009759706.1 PREDICTED: kxDL motif-containing protein 1 [Nicotiana sylvestris] XP_016448060.1 PREDICTED: kxDL motif-containing protein 1-like [Nicotiana tabacum] XP_016487794.1 PREDICTED: kxDL motif-containing protein 1-like [Nicotiana tabacum] Length = 123 Score = 54.3 bits (129), Expect(2) = 2e-10 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF+EY E+C T+V++DFSRN Sbjct: 40 LGRLQDSNAVLSHFNEYSEHCFTEVSADFSRN 71 Score = 38.1 bits (87), Expect(2) = 2e-10 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F + LLKSMKSDLDYIFQKLR Sbjct: 68 FSRNTRLLKSMKSDLDYIFQKLR 90 >XP_009616275.1 PREDICTED: kxDL motif-containing protein 1 [Nicotiana tomentosiformis] XP_009616276.1 PREDICTED: kxDL motif-containing protein 1 [Nicotiana tomentosiformis] XP_009616277.1 PREDICTED: kxDL motif-containing protein 1 [Nicotiana tomentosiformis] XP_018630640.1 PREDICTED: kxDL motif-containing protein 1 [Nicotiana tomentosiformis] Length = 123 Score = 54.3 bits (129), Expect(2) = 2e-10 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF+EY E+C T+V++DFSRN Sbjct: 40 LGRLQDSNAVLSHFNEYSEHCFTEVSADFSRN 71 Score = 38.1 bits (87), Expect(2) = 2e-10 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F + LLKSMKSDLDYIFQKLR Sbjct: 68 FSRNTRLLKSMKSDLDYIFQKLR 90 >XP_011096677.1 PREDICTED: kxDL motif-containing protein 1 [Sesamum indicum] Length = 123 Score = 54.7 bits (130), Expect(2) = 4e-10 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF+EY ENC ++V++DFSRN Sbjct: 40 LGRLQDSNAVLSHFNEYSENCFSEVSADFSRN 71 Score = 37.0 bits (84), Expect(2) = 4e-10 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F + LL+SMKSDLDYIFQKLR Sbjct: 68 FSRNTRLLRSMKSDLDYIFQKLR 90 >KCW48216.1 hypothetical protein EUGRSUZ_K01942, partial [Eucalyptus grandis] Length = 199 Score = 52.8 bits (125), Expect(2) = 6e-10 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF+EY ENC +V+ DFS+N Sbjct: 116 LGRLQDSNAVLSHFNEYSENCFNEVSGDFSKN 147 Score = 38.1 bits (87), Expect(2) = 6e-10 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F K LL+SMKSDLDYIFQKLR Sbjct: 144 FSKNTRLLRSMKSDLDYIFQKLR 166 >XP_017639538.1 PREDICTED: kxDL motif-containing protein 1 [Gossypium arboreum] Length = 125 Score = 53.5 bits (127), Expect(2) = 6e-10 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF+EY E+C +V+SDFSRN Sbjct: 42 LGRLQDSNAVLSHFNEYSEHCFAEVSSDFSRN 73 Score = 37.4 bits (85), Expect(2) = 6e-10 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F + +LKSMKSDLDYIFQKLR Sbjct: 70 FSRNTRMLKSMKSDLDYIFQKLR 92 >XP_012450321.1 PREDICTED: kxDL motif-containing protein 1 [Gossypium raimondii] XP_016751953.1 PREDICTED: kxDL motif-containing protein 1 [Gossypium hirsutum] KJB68587.1 hypothetical protein B456_010G252500 [Gossypium raimondii] KJB68588.1 hypothetical protein B456_010G252500 [Gossypium raimondii] Length = 125 Score = 53.5 bits (127), Expect(2) = 6e-10 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF+EY E+C +V+SDFSRN Sbjct: 42 LGRLQDSNAVLSHFNEYSEHCFAEVSSDFSRN 73 Score = 37.4 bits (85), Expect(2) = 6e-10 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F + +LKSMKSDLDYIFQKLR Sbjct: 70 FSRNARMLKSMKSDLDYIFQKLR 92 >XP_010036602.1 PREDICTED: kxDL motif-containing protein 1 [Eucalyptus grandis] XP_010036603.1 PREDICTED: kxDL motif-containing protein 1 [Eucalyptus grandis] Length = 123 Score = 52.8 bits (125), Expect(2) = 6e-10 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF+EY ENC +V+ DFS+N Sbjct: 40 LGRLQDSNAVLSHFNEYSENCFNEVSGDFSKN 71 Score = 38.1 bits (87), Expect(2) = 6e-10 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F K LL+SMKSDLDYIFQKLR Sbjct: 68 FSKNTRLLRSMKSDLDYIFQKLR 90 >XP_006377666.1 hypothetical protein POPTR_0011s10060g [Populus trichocarpa] ABK93868.1 unknown [Populus trichocarpa] ERP55463.1 hypothetical protein POPTR_0011s10060g [Populus trichocarpa] Length = 119 Score = 52.8 bits (125), Expect(2) = 6e-10 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF+E+ ENC +V++DFSRN Sbjct: 37 LGRLQDSNAVLSHFNEFSENCFAEVSADFSRN 68 Score = 38.1 bits (87), Expect(2) = 6e-10 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F + LLKSMKSDLDYIFQKLR Sbjct: 65 FSRNTRLLKSMKSDLDYIFQKLR 87 >CAN60705.1 hypothetical protein VITISV_025178 [Vitis vinifera] Length = 340 Score = 52.8 bits (125), Expect(2) = 7e-10 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 183 RLGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 +LGRLQD+N VLSHF+EY E+C +V++DFSRN Sbjct: 193 KLGRLQDSNAVLSHFNEYSEHCYAEVSNDFSRN 225 Score = 37.7 bits (86), Expect(2) = 7e-10 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLRL 26 F + LLKSMK+DLDYIFQKLR+ Sbjct: 222 FSRNTRLLKSMKTDLDYIFQKLRI 245 >EYU19127.1 hypothetical protein MIMGU_mgv1a015940mg [Erythranthe guttata] Length = 140 Score = 53.5 bits (127), Expect(2) = 8e-10 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF++Y ENC DV++DFS+N Sbjct: 57 LGRLQDSNAVLSHFNDYSENCFADVSADFSKN 88 Score = 37.0 bits (84), Expect(2) = 8e-10 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F K LL++MKSDLDYIFQKLR Sbjct: 85 FSKNTRLLRTMKSDLDYIFQKLR 107 >XP_012827445.1 PREDICTED: kxDL motif-containing protein 1-like [Erythranthe guttata] Length = 123 Score = 53.5 bits (127), Expect(2) = 8e-10 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF++Y ENC DV++DFS+N Sbjct: 40 LGRLQDSNAVLSHFNDYSENCFADVSADFSKN 71 Score = 37.0 bits (84), Expect(2) = 8e-10 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F K LL++MKSDLDYIFQKLR Sbjct: 68 FSKNTRLLRTMKSDLDYIFQKLR 90 >XP_012827422.1 PREDICTED: kxDL motif-containing protein 1-like [Erythranthe guttata] Length = 123 Score = 53.5 bits (127), Expect(2) = 8e-10 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF++Y ENC DV++DFS+N Sbjct: 40 LGRLQDSNAVLSHFNDYSENCFADVSADFSKN 71 Score = 37.0 bits (84), Expect(2) = 8e-10 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F K LL++MKSDLDYIFQKLR Sbjct: 68 FSKNTRLLRTMKSDLDYIFQKLR 90 >XP_012846856.1 PREDICTED: kxDL motif-containing protein 1-like isoform X2 [Erythranthe guttata] Length = 114 Score = 53.5 bits (127), Expect(2) = 8e-10 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 183 RLGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 RLGRLQD++ VLSHF++Y ENC DV++DFS+N Sbjct: 30 RLGRLQDSSAVLSHFNDYSENCFADVSADFSKN 62 Score = 37.0 bits (84), Expect(2) = 8e-10 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F K LL++MKSDLDYIFQKLR Sbjct: 59 FSKNTRLLRTMKSDLDYIFQKLR 81 >EYU19126.1 hypothetical protein MIMGU_mgv1a015940mg [Erythranthe guttata] Length = 123 Score = 53.5 bits (127), Expect(2) = 8e-10 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF++Y ENC DV++DFS+N Sbjct: 40 LGRLQDSNAVLSHFNDYSENCFADVSADFSKN 71 Score = 37.0 bits (84), Expect(2) = 8e-10 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F K LL++MKSDLDYIFQKLR Sbjct: 68 FSKNTRLLRTMKSDLDYIFQKLR 90 >XP_016559369.1 PREDICTED: kxDL motif-containing protein 1 [Capsicum annuum] XP_016559370.1 PREDICTED: kxDL motif-containing protein 1 [Capsicum annuum] Length = 121 Score = 52.4 bits (124), Expect(2) = 8e-10 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF+EY E+C +V++DFSRN Sbjct: 38 LGRLQDSNAVLSHFNEYSEHCFAEVSADFSRN 69 Score = 38.1 bits (87), Expect(2) = 8e-10 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F + LLKSMKSDLDYIFQKLR Sbjct: 66 FSRNTRLLKSMKSDLDYIFQKLR 88 >CDP17315.1 unnamed protein product [Coffea canephora] Length = 123 Score = 52.4 bits (124), Expect(2) = 8e-10 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -3 Query: 180 LGRLQDNNVVLSHFDEYYENCITDVASDFSRN 85 LGRLQD+N VLSHF+EY E+C +V++DFSRN Sbjct: 40 LGRLQDSNAVLSHFNEYSEHCFAEVSADFSRN 71 Score = 38.1 bits (87), Expect(2) = 8e-10 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 97 FFKKYHLLKSMKSDLDYIFQKLR 29 F + LLKSMKSDLDYIFQKLR Sbjct: 68 FSRNTRLLKSMKSDLDYIFQKLR 90