BLASTX nr result
ID: Phellodendron21_contig00040535
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040535 (296 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007412381.1 subtilisin protease [Melampsora larici-populina 9... 85 4e-17 XP_007409569.1 subtilisin protease [Melampsora larici-populina 9... 68 3e-11 XP_007409614.1 subtilisin protease [Melampsora larici-populina 9... 67 5e-11 XP_003889421.1 hypothetical protein PGTG_21864 [Puccinia gramini... 57 2e-07 XP_003337802.2 hypothetical protein PGTG_19401 [Puccinia gramini... 57 2e-07 KNF05941.1 hypothetical protein PSTG_00932 [Puccinia striiformis... 56 6e-07 KNZ55967.1 hypothetical protein VP01_2530g2 [Puccinia sorghi] 52 2e-06 OAV95385.1 hypothetical protein PTTG_05438 [Puccinia triticina 1... 54 2e-06 KNF05922.1 hypothetical protein PSTG_00915 [Puccinia striiformis... 54 3e-06 XP_003337216.2 hypothetical protein PGTG_18576 [Puccinia gramini... 54 4e-06 >XP_007412381.1 subtilisin protease [Melampsora larici-populina 98AG31] EGG04252.1 subtilisin protease [Melampsora larici-populina 98AG31] Length = 877 Score = 84.7 bits (208), Expect = 4e-17 Identities = 40/92 (43%), Positives = 56/92 (60%) Frame = +3 Query: 3 CSDTERRYPRRSCDGFDLLGEVPDSTYAPMQRSPSLDYFAFAWNRTISLEEGLAIEELPP 182 CS +++YP +SC G +LGEVP RS + WN TISL +G ++ +P Sbjct: 784 CSMGKKKYPHKSCHGVLILGEVPGVECTACYRSSVKRTWLDTWNGTISLGKGKPLKHVPH 843 Query: 183 GRYRILMRALHLTSDPKSVDSYETWVSPAVVL 278 G YRIL+ ALH SDPK +SY++W SP +V+ Sbjct: 844 GEYRILIEALHSNSDPKDPESYDSWYSPVIVI 875 >XP_007409569.1 subtilisin protease [Melampsora larici-populina 98AG31] EGG07127.1 subtilisin protease [Melampsora larici-populina 98AG31] Length = 912 Score = 68.2 bits (165), Expect = 3e-11 Identities = 34/86 (39%), Positives = 50/86 (58%) Frame = +3 Query: 21 RYPRRSCDGFDLLGEVPDSTYAPMQRSPSLDYFAFAWNRTISLEEGLAIEELPPGRYRIL 200 R+PRR+ DG LLGE+PDS RS S + WN T+S +EE+P GRY++L Sbjct: 825 RFPRRTSDGLLLLGEIPDSESLYSPRSGSKLVWMQKWNGTLSTVTNSTLEEVPDGRYKVL 884 Query: 201 MRALHLTSDPKSVDSYETWVSPAVVL 278 ++AL + + E W+SP +V+ Sbjct: 885 IQALRVFGNRDDPLDCENWLSPVIVI 910 >XP_007409614.1 subtilisin protease [Melampsora larici-populina 98AG31] EGG07172.1 subtilisin protease [Melampsora larici-populina 98AG31] Length = 893 Score = 67.4 bits (163), Expect = 5e-11 Identities = 32/95 (33%), Positives = 53/95 (55%), Gaps = 1/95 (1%) Frame = +3 Query: 3 CSDTERRYPRRSCDGFDLLGEVPDSTYAPMQRSPSL-DYFAFAWNRTISLEEGLAIEELP 179 C + +P +SC+G +++GE+ A RS S D ++ WN T+ + L + +P Sbjct: 799 CVTLKGNFPMKSCEGLNIMGEIGHGHMARYPRSRSAEDTYSKPWNGTLYVGSNLPHKMVP 858 Query: 180 PGRYRILMRALHLTSDPKSVDSYETWVSPAVVLSD 284 G+Y+IL+RAL L D + YETW+S + + D Sbjct: 859 AGKYKILIRALRLAGDSTNEHDYETWLSNTITIQD 893 >XP_003889421.1 hypothetical protein PGTG_21864 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EHS63822.1 hypothetical protein PGTG_21864 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 928 Score = 57.0 bits (136), Expect = 2e-07 Identities = 30/84 (35%), Positives = 44/84 (52%) Frame = +3 Query: 33 RSCDGFDLLGEVPDSTYAPMQRSPSLDYFAFAWNRTISLEEGLAIEELPPGRYRILMRAL 212 +S G LLG +PDS + RS + D + WN T+ + LP G Y++L+RAL Sbjct: 842 KSFRGSRLLGLIPDSDTVSLSRSSADDSYTQPWNATVVTKTKKKPHFLPNGNYKVLLRAL 901 Query: 213 HLTSDPKSVDSYETWVSPAVVLSD 284 +T + + YE WVSP L + Sbjct: 902 RVTGNKANEADYEYWVSPQFKLKN 925 >XP_003337802.2 hypothetical protein PGTG_19401 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP93383.2 hypothetical protein PGTG_19401 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 931 Score = 57.0 bits (136), Expect = 2e-07 Identities = 30/84 (35%), Positives = 44/84 (52%) Frame = +3 Query: 33 RSCDGFDLLGEVPDSTYAPMQRSPSLDYFAFAWNRTISLEEGLAIEELPPGRYRILMRAL 212 +S G LLG +PDS + RS + D + WN T+ + LP G Y++L+RAL Sbjct: 845 KSFRGSRLLGLIPDSDTVSLSRSSADDSYTQPWNATVVTKTKKKPHFLPNGNYKVLLRAL 904 Query: 213 HLTSDPKSVDSYETWVSPAVVLSD 284 +T + + YE WVSP L + Sbjct: 905 RVTGNKTNEADYEYWVSPQFKLKN 928 >KNF05941.1 hypothetical protein PSTG_00932 [Puccinia striiformis f. sp. tritici PST-78] Length = 890 Score = 55.8 bits (133), Expect = 6e-07 Identities = 27/78 (34%), Positives = 43/78 (55%) Frame = +3 Query: 45 GFDLLGEVPDSTYAPMQRSPSLDYFAFAWNRTISLEEGLAIEELPPGRYRILMRALHLTS 224 G +LLG +P S RS + WN TI E + +P G+Y++L+RAL +T Sbjct: 811 GINLLGLIPTSDSEMFSRSGQHEVQELEWNATIVDNEFSKPKRIPDGKYKVLLRALRVTG 870 Query: 225 DPKSVDSYETWVSPAVVL 278 D ++ ++TW+SP + L Sbjct: 871 DLENEADFDTWLSPIIYL 888 >KNZ55967.1 hypothetical protein VP01_2530g2 [Puccinia sorghi] Length = 89 Score = 51.6 bits (122), Expect = 2e-06 Identities = 28/80 (35%), Positives = 42/80 (52%) Frame = +3 Query: 45 GFDLLGEVPDSTYAPMQRSPSLDYFAFAWNRTISLEEGLAIEELPPGRYRILMRALHLTS 224 G L+G +PDS + R+ + F WN TI E LP G Y++L+RAL +T Sbjct: 3 GSRLIGFLPDSEDRFLPRNDADGTFTQTWNATIVTREKKKPHFLPDGSYKVLLRALRITG 62 Query: 225 DPKSVDSYETWVSPAVVLSD 284 +S ++ WVSP + L + Sbjct: 63 RNESEADWDYWVSPEIKLKN 82 >OAV95385.1 hypothetical protein PTTG_05438 [Puccinia triticina 1-1 BBBD Race 1] Length = 932 Score = 54.3 bits (129), Expect = 2e-06 Identities = 33/86 (38%), Positives = 45/86 (52%), Gaps = 2/86 (2%) Frame = +3 Query: 33 RSCDGFDLLGEVPDSTYAPMQRSPSLDYFAFAWNRTI--SLEEGLAIEELPPGRYRILMR 206 +S G L+G VPDS + RS S D + WN TI S + LP G Y++L+R Sbjct: 843 KSFRGSRLIGLVPDSDTPSLPRSSSDDAYTQPWNATIVASAKSKKKPHFLPNGNYKLLIR 902 Query: 207 ALHLTSDPKSVDSYETWVSPAVVLSD 284 AL +T + YE WVSP +L + Sbjct: 903 ALRVTGLKTNESDYEYWVSPQFMLKN 928 >KNF05922.1 hypothetical protein PSTG_00915 [Puccinia striiformis f. sp. tritici PST-78] Length = 858 Score = 53.9 bits (128), Expect = 3e-06 Identities = 31/84 (36%), Positives = 43/84 (51%) Frame = +3 Query: 33 RSCDGFDLLGEVPDSTYAPMQRSPSLDYFAFAWNRTISLEEGLAIEELPPGRYRILMRAL 212 +S G LLG +PDS QRS + D F WN T+ +E L G Y++L RAL Sbjct: 772 KSFMGSRLLGLIPDSDSVSFQRSTAGDSFMSPWNATVVTKEKEKPHFLHNGSYKVLFRAL 831 Query: 213 HLTSDPKSVDSYETWVSPAVVLSD 284 +T + Y+ WVSP L++ Sbjct: 832 RVTGRKTNEADYDYWVSPEFNLTN 855 >XP_003337216.2 hypothetical protein PGTG_18576 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP92797.2 hypothetical protein PGTG_18576 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 893 Score = 53.5 bits (127), Expect = 4e-06 Identities = 26/79 (32%), Positives = 43/79 (54%) Frame = +3 Query: 45 GFDLLGEVPDSTYAPMQRSPSLDYFAFAWNRTISLEEGLAIEELPPGRYRILMRALHLTS 224 G DLLG +P S RS + WN T+ E + +P G+Y++L+RAL +T Sbjct: 814 GIDLLGLIPTSDSELFSRSGMHEVQELDWNATVLESEYSKPKRIPGGKYKVLLRALKVTG 873 Query: 225 DPKSVDSYETWVSPAVVLS 281 D ++ ++ W+SP + L+ Sbjct: 874 DLENEGDFDRWLSPLIHLT 892