BLASTX nr result
ID: Phellodendron21_contig00040440
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040440 (308 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007585614.1 putative thioredoxin protein [Neofusicoccum parvu... 94 9e-23 XP_007776414.1 hypothetical protein W97_00308 [Coniosporium apol... 93 1e-22 GAM85032.1 hypothetical protein ANO11243_030350 [fungal sp. No.1... 92 5e-22 KKY26819.1 putative thioredoxin [Diplodia seriata] 91 6e-22 XP_020135377.1 thioredoxin [Diplodia corticola] OJD40534.1 thior... 93 8e-22 XP_001799253.1 hypothetical protein SNOG_08948 [Parastagonospora... 92 1e-21 EKG13018.1 Thioredoxin [Macrophomina phaseolina MS6] 90 3e-21 OAL03829.1 thioredoxin-domain-containing protein [Stagonospora s... 91 6e-21 XP_007680953.1 hypothetical protein BAUCODRAFT_39110 [Baudoinia ... 87 4e-20 KXL43583.1 hypothetical protein FE78DRAFT_92471 [Acidomyces rich... 88 4e-20 XP_001939504.1 thioredoxin [Pyrenophora tritici-repentis Pt-1C-B... 87 6e-20 XP_016260461.1 thioredoxin, variant [Exophiala oligosperma] KIW4... 86 8e-20 APA13033.1 hypothetical protein sscle_10g078030 [Sclerotinia scl... 86 1e-19 XP_014080053.1 hypothetical protein COCC4DRAFT_135611 [Bipolaris... 86 1e-19 OCK78861.1 thioredoxin [Lepidopterella palustris CBS 459.81] 86 1e-19 KZM23918.1 protein disulfide oxidoreductase [Ascochyta rabiei] 86 2e-19 AAQ87932.1 Cop c 2-like protein [Curvularia lunata] 86 2e-19 XP_013320902.1 thioredoxin [Exophiala xenobiotica] KIW60318.1 th... 86 2e-19 OCT44987.1 Thioredoxin [Cladophialophora carrionii] 86 2e-19 XP_008730195.1 thioredoxin [Cladophialophora carrionii CBS 160.5... 86 2e-19 >XP_007585614.1 putative thioredoxin protein [Neofusicoccum parvum UCRNP2] EOD46908.1 putative thioredoxin protein [Neofusicoccum parvum UCRNP2] Length = 107 Score = 93.6 bits (231), Expect = 9e-23 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHLSA 157 K+DVDEVP+VAQELGIRAMPTFLLFK GEK+GEVVGANPKALEAAI+QH A Sbjct: 56 KLDVDEVPDVAQELGIRAMPTFLLFKGGEKVGEVVGANPKALEAAIKQHSEA 107 >XP_007776414.1 hypothetical protein W97_00308 [Coniosporium apollinis CBS 100218] EON61097.1 hypothetical protein W97_00308 [Coniosporium apollinis CBS 100218] Length = 110 Score = 93.2 bits (230), Expect = 1e-22 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHL 151 K+DVDEVPEVAQELGIRAMPTFLLFKNGEK+GEVVGANPKALEAAI+ +L Sbjct: 59 KLDVDEVPEVAQELGIRAMPTFLLFKNGEKVGEVVGANPKALEAAIKSNL 108 >GAM85032.1 hypothetical protein ANO11243_030350 [fungal sp. No.11243] Length = 105 Score = 91.7 bits (226), Expect = 5e-22 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHL 151 K+DVDEVP+VAQELGIRAMPTFLLFKNGEK+GEVVGANPKALE+AIQ +L Sbjct: 56 KLDVDEVPDVAQELGIRAMPTFLLFKNGEKVGEVVGANPKALESAIQGNL 105 >KKY26819.1 putative thioredoxin [Diplodia seriata] Length = 101 Score = 91.3 bits (225), Expect = 6e-22 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHL 151 K+DVDEVP+VAQELGIRAMPTFLLFK GEK+GEVVGANPKALEAAI+Q L Sbjct: 49 KLDVDEVPDVAQELGIRAMPTFLLFKGGEKVGEVVGANPKALEAAIKQQL 98 >XP_020135377.1 thioredoxin [Diplodia corticola] OJD40534.1 thioredoxin [Diplodia corticola] Length = 160 Score = 92.8 bits (229), Expect = 8e-22 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHL 151 K+DVDEVP+VAQELGIRAMPTFLLFK GEK+GEVVGANPKALE AI+QHL Sbjct: 108 KLDVDEVPDVAQELGIRAMPTFLLFKGGEKVGEVVGANPKALETAIRQHL 157 >XP_001799253.1 hypothetical protein SNOG_08948 [Parastagonospora nodorum SN15] EAT84116.1 hypothetical protein SNOG_08948 [Parastagonospora nodorum SN15] Length = 159 Score = 92.4 bits (228), Expect = 1e-21 Identities = 41/52 (78%), Positives = 49/52 (94%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHLSA 157 K+D+DEVP++AQELGIRAMPTF+ FKNGEK+GEVVGANPKA+EA IQ+H SA Sbjct: 108 KLDIDEVPDIAQELGIRAMPTFVFFKNGEKVGEVVGANPKAIEAGIQEHASA 159 >EKG13018.1 Thioredoxin [Macrophomina phaseolina MS6] Length = 107 Score = 89.7 bits (221), Expect = 3e-21 Identities = 42/52 (80%), Positives = 49/52 (94%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHLSA 157 K+DVDEVP+VAQELGIRAMPTFLLFK GEK+ EVVGANPKAL+AAI++H+ A Sbjct: 55 KLDVDEVPDVAQELGIRAMPTFLLFKGGEKVDEVVGANPKALQAAIEKHVGA 106 >OAL03829.1 thioredoxin-domain-containing protein [Stagonospora sp. SRC1lsM3a] Length = 159 Score = 90.5 bits (223), Expect = 6e-21 Identities = 41/52 (78%), Positives = 48/52 (92%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHLSA 157 K+D+DEVP+VAQELGIRAMPTF+ FKNGEK+GEVVGANPKA+EA IQ+H A Sbjct: 108 KLDIDEVPDVAQELGIRAMPTFVFFKNGEKVGEVVGANPKAIEAGIQEHNKA 159 >XP_007680953.1 hypothetical protein BAUCODRAFT_39110 [Baudoinia panamericana UAMH 10762] EMC91960.1 hypothetical protein BAUCODRAFT_39110 [Baudoinia panamericana UAMH 10762] Length = 108 Score = 87.0 bits (214), Expect = 4e-20 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHL 151 K+DVDEVPEVAQEL +RAMPTFLLFKNGEK+GEVVGANP ALE AI+ +L Sbjct: 59 KLDVDEVPEVAQELAVRAMPTFLLFKNGEKVGEVVGANPSALETAIKSNL 108 >KXL43583.1 hypothetical protein FE78DRAFT_92471 [Acidomyces richmondensis] KYG44386.1 hypothetical protein M433DRAFT_155661 [Acidomyces richmondensis BFW] Length = 152 Score = 88.2 bits (217), Expect = 4e-20 Identities = 41/50 (82%), Positives = 48/50 (96%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHL 151 K+DVD+VP+VAQELGIRAMPTFLLFK+GEK+GEVVGANP ALE AI++HL Sbjct: 103 KLDVDDVPDVAQELGIRAMPTFLLFKDGEKVGEVVGANPTALEGAIKKHL 152 >XP_001939504.1 thioredoxin [Pyrenophora tritici-repentis Pt-1C-BFP] EDU42223.1 thioredoxin [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 111 Score = 86.7 bits (213), Expect = 6e-20 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHLS 154 KIDVDEVP+VAQELGIRAMPTFL FK G+K+ EVVGANPKALEAAIQ +++ Sbjct: 61 KIDVDEVPDVAQELGIRAMPTFLFFKGGDKVAEVVGANPKALEAAIQSNIA 111 >XP_016260461.1 thioredoxin, variant [Exophiala oligosperma] KIW40245.1 thioredoxin, variant [Exophiala oligosperma] Length = 110 Score = 86.3 bits (212), Expect = 8e-20 Identities = 40/50 (80%), Positives = 48/50 (96%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHL 151 KIDVDEVP+VAQELG+RAMPTF+LFKNGEK+GEVVGAN +ALE AI+++L Sbjct: 61 KIDVDEVPDVAQELGVRAMPTFMLFKNGEKVGEVVGANKRALEQAIKENL 110 >APA13033.1 hypothetical protein sscle_10g078030 [Sclerotinia sclerotiorum 1980 UF-70] Length = 106 Score = 85.9 bits (211), Expect = 1e-19 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHLSA 157 KIDVDE+PEVAQELG+RAMPTFL+FK EKIGEVVGANP ALE AIQ+ L+A Sbjct: 55 KIDVDELPEVAQELGVRAMPTFLIFKGSEKIGEVVGANPPALELAIQKALAA 106 >XP_014080053.1 hypothetical protein COCC4DRAFT_135611 [Bipolaris maydis ATCC 48331] EMD86195.1 hypothetical protein COCHEDRAFT_1228264 [Bipolaris maydis C5] ENI06144.1 hypothetical protein COCC4DRAFT_135611 [Bipolaris maydis ATCC 48331] Length = 110 Score = 85.9 bits (211), Expect = 1e-19 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHL 151 K+DVDEVP+VAQELGIRAMPTFLLFK G+K+ EVVGANPKALEAAI+ +L Sbjct: 60 KLDVDEVPDVAQELGIRAMPTFLLFKGGDKVAEVVGANPKALEAAIKANL 109 >OCK78861.1 thioredoxin [Lepidopterella palustris CBS 459.81] Length = 113 Score = 85.9 bits (211), Expect = 1e-19 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHL 151 K+DVDEVP+VAQELGIRAMPTF+LFK+GEK+ EVVGANPKALEAAI +L Sbjct: 59 KLDVDEVPDVAQELGIRAMPTFILFKDGEKVAEVVGANPKALEAAITANL 108 >KZM23918.1 protein disulfide oxidoreductase [Ascochyta rabiei] Length = 110 Score = 85.5 bits (210), Expect = 2e-19 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHL 151 KIDVDEVP+VAQELGIRAMPTFLLFK G+K+ EVVGANPKALEAAI+ ++ Sbjct: 59 KIDVDEVPDVAQELGIRAMPTFLLFKGGDKVAEVVGANPKALEAAIKANV 108 >AAQ87932.1 Cop c 2-like protein [Curvularia lunata] Length = 112 Score = 85.5 bits (210), Expect = 2e-19 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQH 148 K+DVD+VP+VAQELGIRAMPTFLLFK G+KI EVVGANPKALEAAIQ + Sbjct: 62 KLDVDDVPDVAQELGIRAMPTFLLFKGGDKISEVVGANPKALEAAIQSN 110 >XP_013320902.1 thioredoxin [Exophiala xenobiotica] KIW60318.1 thioredoxin [Exophiala xenobiotica] Length = 139 Score = 86.3 bits (212), Expect = 2e-19 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHL 151 KIDVDEVP++AQELG+RAMPTF+LFKNGEK+GEVVGAN KALE AI+ +L Sbjct: 90 KIDVDEVPDIAQELGVRAMPTFMLFKNGEKVGEVVGANKKALEQAIKDNL 139 >OCT44987.1 Thioredoxin [Cladophialophora carrionii] Length = 141 Score = 86.3 bits (212), Expect = 2e-19 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHL 151 K+DVDEVP+VAQELG+RAMPTF+ FKNGEK+ EVVGAN +ALEAAIQ+H+ Sbjct: 92 KVDVDEVPDVAQELGVRAMPTFMFFKNGEKVDEVVGANVRALEAAIQKHI 141 >XP_008730195.1 thioredoxin [Cladophialophora carrionii CBS 160.54] ETI21314.1 thioredoxin [Cladophialophora carrionii CBS 160.54] Length = 141 Score = 86.3 bits (212), Expect = 2e-19 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = +2 Query: 2 KIDVDEVPEVAQELGIRAMPTFLLFKNGEKIGEVVGANPKALEAAIQQHL 151 K+DVDEVP+VAQELG+RAMPTF+ FKNGEK+ EVVGAN +ALEAAIQ+H+ Sbjct: 92 KVDVDEVPDVAQELGVRAMPTFMFFKNGEKVDEVVGANVRALEAAIQKHI 141