BLASTX nr result
ID: Phellodendron21_contig00040371
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040371 (370 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007404411.1 hypothetical protein MELLADRAFT_59206 [Melampsora... 60 2e-08 >XP_007404411.1 hypothetical protein MELLADRAFT_59206 [Melampsora larici-populina 98AG31] EGG12036.1 hypothetical protein MELLADRAFT_59206 [Melampsora larici-populina 98AG31] Length = 238 Score = 60.5 bits (145), Expect = 2e-08 Identities = 33/67 (49%), Positives = 44/67 (65%) Frame = +1 Query: 22 NLIEIANDLQKQVETRPEQLKSLEKAITIEAKNACRLHLQNLKVSSDAKAFKRKYASLVE 201 N E A DL K VE RP LK + +++T EAK +CRLHLQNLK +SD K F+ +E Sbjct: 169 NWEETAQDLLKDVEARPSLLKDVSESLTNEAKKSCRLHLQNLK-TSDGKIFENDSYDQME 227 Query: 202 EVL*KNI 222 ++L KN+ Sbjct: 228 KLLHKNM 234