BLASTX nr result
ID: Phellodendron21_contig00040356
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040356 (275 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007410374.1 hypothetical protein MELLADRAFT_71940 [Melampsora... 125 2e-34 XP_007417029.1 hypothetical protein MELLADRAFT_118240 [Melampsor... 125 2e-34 OAV91671.1 hypothetical protein PTTG_27912 [Puccinia triticina 1... 119 9e-33 KNZ47145.1 U1 small nuclear ribonucleoprotein C-1 [Puccinia sorghi] 120 1e-32 XP_003328680.1 U1 small nuclear ribonucleoprotein C [Puccinia gr... 119 4e-32 XP_003338031.1 U1 small nuclear ribonucleoprotein C [Puccinia gr... 119 4e-32 KNE89818.1 hypothetical protein PSTG_16718 [Puccinia striiformis... 119 4e-32 KIY49382.1 zf-U1-domain-containing protein, partial [Fistulina h... 105 4e-28 KIO24481.1 hypothetical protein M407DRAFT_37660, partial [Tulasn... 104 9e-28 KZT60771.1 zf-U1-domain-containing protein, partial [Calocera co... 103 1e-27 KIL70185.1 hypothetical protein M378DRAFT_608332 [Amanita muscar... 105 4e-27 KDQ15438.1 hypothetical protein BOTBODRAFT_31767 [Botryobasidium... 106 9e-27 KIM46380.1 hypothetical protein M413DRAFT_24113 [Hebeloma cylind... 105 2e-26 GAV98999.1 zf-U1-domain-containing protein [Lentinula edodes] 104 2e-26 KIO12649.1 hypothetical protein M404DRAFT_993637 [Pisolithus tin... 105 2e-26 XP_007382417.1 zf-U1-domain-containing protein [Punctularia stri... 105 2e-26 KDR83949.1 hypothetical protein GALMADRAFT_236458 [Galerina marg... 105 2e-26 KIP07705.1 hypothetical protein PHLGIDRAFT_117879 [Phlebiopsis g... 102 2e-26 KJA29861.1 hypothetical protein HYPSUDRAFT_81491 [Hypholoma subl... 105 2e-26 KYQ42655.1 U1 small nuclear ribonucleoprotein C [Hypsizygus marm... 105 3e-26 >XP_007410374.1 hypothetical protein MELLADRAFT_71940 [Melampsora larici-populina 98AG31] EGG06136.1 hypothetical protein MELLADRAFT_71940 [Melampsora larici-populina 98AG31] Length = 210 Score = 125 bits (315), Expect = 2e-34 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +2 Query: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES Sbjct: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 59 >XP_007417029.1 hypothetical protein MELLADRAFT_118240 [Melampsora larici-populina 98AG31] EGF99721.1 hypothetical protein MELLADRAFT_118240 [Melampsora larici-populina 98AG31] Length = 210 Score = 125 bits (315), Expect = 2e-34 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +2 Query: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES Sbjct: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 59 >OAV91671.1 hypothetical protein PTTG_27912 [Puccinia triticina 1-1 BBBD Race 1] Length = 137 Score = 119 bits (298), Expect = 9e-33 Identities = 54/58 (93%), Positives = 57/58 (98%) Frame = +2 Query: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQ+ IDEITRM+E+ Sbjct: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQSYIDEITRMFET 59 >KNZ47145.1 U1 small nuclear ribonucleoprotein C-1 [Puccinia sorghi] Length = 190 Score = 120 bits (301), Expect = 1e-32 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = +2 Query: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQ+ IDEITRM+ES Sbjct: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQSYIDEITRMFES 59 >XP_003328680.1 U1 small nuclear ribonucleoprotein C [Puccinia graminis f. sp. tritici CRL 75-36-700-3] E3KIY6.1 RecName: Full=U1 small nuclear ribonucleoprotein C-2; Short=U1 snRNP C-2; Short=U1-C-2; Short=U1C-2 EFP84261.1 U1 small nuclear ribonucleoprotein C [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 188 Score = 119 bits (298), Expect = 4e-32 Identities = 54/58 (93%), Positives = 57/58 (98%) Frame = +2 Query: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQ+ IDEITRM+E+ Sbjct: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQSYIDEITRMFET 59 >XP_003338031.1 U1 small nuclear ribonucleoprotein C [Puccinia graminis f. sp. tritici CRL 75-36-700-3] E3LAN7.1 RecName: Full=U1 small nuclear ribonucleoprotein C-1; Short=U1 snRNP C-1; Short=U1-C-1; Short=U1C-1 EFP93612.1 U1 small nuclear ribonucleoprotein C [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 190 Score = 119 bits (298), Expect = 4e-32 Identities = 54/58 (93%), Positives = 57/58 (98%) Frame = +2 Query: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQ+ IDEITRM+E+ Sbjct: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQSYIDEITRMFET 59 >KNE89818.1 hypothetical protein PSTG_16718 [Puccinia striiformis f. sp. tritici PST-78] Length = 191 Score = 119 bits (298), Expect = 4e-32 Identities = 54/58 (93%), Positives = 57/58 (98%) Frame = +2 Query: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQ+ IDEITRM+E+ Sbjct: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQSYIDEITRMFET 59 >KIY49382.1 zf-U1-domain-containing protein, partial [Fistulina hepatica ATCC 64428] Length = 57 Score = 105 bits (261), Expect = 4e-28 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = +2 Query: 5 KYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 K+YCDYCDVFL +S SVRKAHNSGRNHL NVRDYY+SLGHDKAQNIID+IT YES Sbjct: 1 KHYCDYCDVFLTHDSASVRKAHNSGRNHLANVRDYYASLGHDKAQNIIDQITAAYES 57 >KIO24481.1 hypothetical protein M407DRAFT_37660, partial [Tulasnella calospora MUT 4182] Length = 58 Score = 104 bits (259), Expect = 9e-28 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = +2 Query: 5 KYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYE 172 K+YCDYCDV+L +S +VRKAHNSGRNHL NVRDYY+SLGHDKAQNIIDEITR YE Sbjct: 3 KHYCDYCDVYLTHDSAAVRKAHNSGRNHLQNVRDYYASLGHDKAQNIIDEITRAYE 58 >KZT60771.1 zf-U1-domain-containing protein, partial [Calocera cornea HHB12733] Length = 61 Score = 103 bits (258), Expect = 1e-27 Identities = 46/57 (80%), Positives = 52/57 (91%) Frame = +2 Query: 5 KYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 K+YCDYCDVFL +S SVRKAHNSGRNHL NVRDYY+SLGHDKAQ+IID+IT+ YES Sbjct: 3 KHYCDYCDVFLTHDSASVRKAHNSGRNHLQNVRDYYASLGHDKAQDIIDQITKAYES 59 >KIL70185.1 hypothetical protein M378DRAFT_608332 [Amanita muscaria Koide BX008] Length = 135 Score = 105 bits (261), Expect = 4e-27 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = +2 Query: 5 KYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 K+YCDYCDVFL +S SVRKAHNSGRNHL NVRDYY+SLGHDKAQNIID+IT YES Sbjct: 3 KHYCDYCDVFLTHDSASVRKAHNSGRNHLANVRDYYASLGHDKAQNIIDQITAAYES 59 >KDQ15438.1 hypothetical protein BOTBODRAFT_31767 [Botryobasidium botryosum FD-172 SS1] Length = 221 Score = 106 bits (265), Expect = 9e-27 Identities = 46/58 (79%), Positives = 54/58 (93%) Frame = +2 Query: 2 GKYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 GK+YCDYCDV+L +S SVRKAHNSGRNH++NVRDYY+SLGHDKAQNIID+IT+ YES Sbjct: 2 GKHYCDYCDVYLTHDSTSVRKAHNSGRNHISNVRDYYASLGHDKAQNIIDQITQAYES 59 >KIM46380.1 hypothetical protein M413DRAFT_24113 [Hebeloma cylindrosporum h7] Length = 203 Score = 105 bits (262), Expect = 2e-26 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = +2 Query: 5 KYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 K+YCDYCDVFL +S SVRKAHNSGRNHL+NVRDYY+SLGHDKAQNIID+IT YES Sbjct: 3 KHYCDYCDVFLTHDSTSVRKAHNSGRNHLSNVRDYYASLGHDKAQNIIDQITSAYES 59 >GAV98999.1 zf-U1-domain-containing protein [Lentinula edodes] Length = 166 Score = 104 bits (259), Expect = 2e-26 Identities = 46/57 (80%), Positives = 52/57 (91%) Frame = +2 Query: 5 KYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 K+YCDYCDVFL +S SVRKAHNSGRNHL+NV+DYY+SLGHDKAQNIID+IT YES Sbjct: 3 KHYCDYCDVFLTHDSASVRKAHNSGRNHLSNVKDYYASLGHDKAQNIIDQITSAYES 59 >KIO12649.1 hypothetical protein M404DRAFT_993637 [Pisolithus tinctorius Marx 270] Length = 193 Score = 105 bits (261), Expect = 2e-26 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = +2 Query: 5 KYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 K+YCDYCDVFL +S SVRKAHNSGRNHL NVRDYY+SLGHDKAQNIID+IT YES Sbjct: 3 KHYCDYCDVFLTHDSASVRKAHNSGRNHLANVRDYYASLGHDKAQNIIDQITAAYES 59 >XP_007382417.1 zf-U1-domain-containing protein [Punctularia strigosozonata HHB-11173 SS5] EIN10905.1 zf-U1-domain-containing protein [Punctularia strigosozonata HHB-11173 SS5] Length = 193 Score = 105 bits (261), Expect = 2e-26 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = +2 Query: 5 KYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 K+YCDYCDVFL +S SVRKAHNSGRNHL NVRDYY+SLGHDKAQNIID+IT YES Sbjct: 3 KHYCDYCDVFLTHDSASVRKAHNSGRNHLANVRDYYASLGHDKAQNIIDQITAAYES 59 >KDR83949.1 hypothetical protein GALMADRAFT_236458 [Galerina marginata CBS 339.88] Length = 208 Score = 105 bits (262), Expect = 2e-26 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = +2 Query: 5 KYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 K+YCDYCDVFL +S SVRKAHNSGRNHL+NVRDYY+SLGHDKAQNIID+IT YES Sbjct: 3 KHYCDYCDVFLTHDSTSVRKAHNSGRNHLSNVRDYYASLGHDKAQNIIDQITSAYES 59 >KIP07705.1 hypothetical protein PHLGIDRAFT_117879 [Phlebiopsis gigantea 11061_1 CR5-6] Length = 106 Score = 102 bits (254), Expect = 2e-26 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = +2 Query: 5 KYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 K+YCDYCDVFL +S SVRKAHNSGRNHL+NVRDYY+SLGHDKAQ+IID+IT YE+ Sbjct: 3 KHYCDYCDVFLTHDSASVRKAHNSGRNHLSNVRDYYASLGHDKAQSIIDQITAAYET 59 >KJA29861.1 hypothetical protein HYPSUDRAFT_81491 [Hypholoma sublateritium FD-334 SS-4] Length = 214 Score = 105 bits (262), Expect = 2e-26 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = +2 Query: 5 KYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 K+YCDYCDVFL +S SVRKAHNSGRNHL+NVRDYY+SLGHDKAQNIID+IT YES Sbjct: 3 KHYCDYCDVFLTHDSTSVRKAHNSGRNHLSNVRDYYASLGHDKAQNIIDQITSAYES 59 >KYQ42655.1 U1 small nuclear ribonucleoprotein C [Hypsizygus marmoreus] Length = 223 Score = 105 bits (262), Expect = 3e-26 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = +2 Query: 5 KYYCDYCDVFLVSESPSVRKAHNSGRNHLTNVRDYYSSLGHDKAQNIIDEITRMYES 175 K+YCDYCDVFL +S SVRKAHNSGRNHL+NVRDYY+SLGHDKAQNIID+IT YES Sbjct: 3 KHYCDYCDVFLTHDSTSVRKAHNSGRNHLSNVRDYYASLGHDKAQNIIDQITSAYES 59