BLASTX nr result
ID: Phellodendron21_contig00040338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040338 (422 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CRX78938.1 hypothetical protein ls5930a1_00003, partial [Leucosp... 57 7e-07 XP_016269821.1 protein serine/threonine kinase [Rhodotorula toru... 57 7e-07 XP_018271214.1 hypothetical protein RHOBADRAFT_36013 [Rhodotorul... 57 1e-06 XP_016291613.1 Protein kinase [Kalmanozyma brasiliensis GHG001] ... 57 1e-06 XP_012193034.1 other/HAL protein kinase [Pseudozyma hubeiensis S... 57 1e-06 XP_014659258.1 pkinase-domain-containing protein [Moesziomyces a... 57 1e-06 GAC73940.1 checkpoint kinase [Moesziomyces antarcticus T-34] 57 1e-06 CBQ68113.1 related to HRK1-Protein kinase with a role in ion hom... 57 1e-06 XP_011386487.1 hypothetical protein UMAG_00691 [Ustilago maydis ... 57 1e-06 SAM59588.1 related to HRK1-Protein kinase with a role in ion hom... 57 1e-06 CDI51623.1 related to HRK1-Protein kinase with a role in ion hom... 57 1e-06 CCF51180.1 related to HRK1-Protein kinase with a role in ion hom... 57 1e-06 CDW98261.1 hypothetical protein [Sporisorium scitamineum] CDU233... 57 1e-06 ETS63937.1 hypothetical protein PaG_02266 [Moesziomyces aphidis ... 57 1e-06 XP_014570481.1 hypothetical protein L969DRAFT_44096 [Mixia osmun... 56 2e-06 CEH15821.1 pkinase-domain-containing protein [Ceraceosorus bomba... 56 2e-06 KDE09044.1 HAL protein kinase [Microbotryum lychnidis-dioicae p1... 55 3e-06 XP_007879109.1 hypothetical protein PFL1_03401 [Anthracocystis f... 55 4e-06 KIJ16806.1 hypothetical protein PAXINDRAFT_74230 [Paxillus invol... 54 1e-05 >CRX78938.1 hypothetical protein ls5930a1_00003, partial [Leucosporidium scottii] Length = 754 Score = 57.4 bits (137), Expect = 7e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L+KKYGKWGKVLGSGAGGTVRL Sbjct: 311 PLGEDHAHLQKKYGKWGKVLGSGAGGTVRL 340 >XP_016269821.1 protein serine/threonine kinase [Rhodotorula toruloides NP11] EMS18702.1 protein serine/threonine kinase [Rhodotorula toruloides NP11] CDR48879.1 RHTO0S21e00826g1_1 [Rhodotorula toruloides] Length = 893 Score = 57.4 bits (137), Expect = 7e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L+KKYGKWGKVLGSGAGGTVRL Sbjct: 370 PLGEDHAHLQKKYGKWGKVLGSGAGGTVRL 399 >XP_018271214.1 hypothetical protein RHOBADRAFT_36013 [Rhodotorula graminis WP1] KPV75165.1 hypothetical protein RHOBADRAFT_36013 [Rhodotorula graminis WP1] Length = 478 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGKVLGSGAGGTVRL Sbjct: 131 PLGEDHAHLSKKYGKWGKVLGSGAGGTVRL 160 >XP_016291613.1 Protein kinase [Kalmanozyma brasiliensis GHG001] EST06624.1 Protein kinase [Kalmanozyma brasiliensis GHG001] Length = 847 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGKVLGSGAGGTVRL Sbjct: 290 PLGEDHAHLAKKYGKWGKVLGSGAGGTVRL 319 >XP_012193034.1 other/HAL protein kinase [Pseudozyma hubeiensis SY62] GAC99447.1 other/HAL protein kinase [Pseudozyma hubeiensis SY62] Length = 857 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGKVLGSGAGGTVRL Sbjct: 300 PLGEDHAHLAKKYGKWGKVLGSGAGGTVRL 329 >XP_014659258.1 pkinase-domain-containing protein [Moesziomyces antarcticus] GAK61957.1 pkinase-domain-containing protein [Moesziomyces antarcticus] Length = 858 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGKVLGSGAGGTVRL Sbjct: 304 PLGEDHAHLAKKYGKWGKVLGSGAGGTVRL 333 >GAC73940.1 checkpoint kinase [Moesziomyces antarcticus T-34] Length = 858 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGKVLGSGAGGTVRL Sbjct: 304 PLGEDHAHLAKKYGKWGKVLGSGAGGTVRL 333 >CBQ68113.1 related to HRK1-Protein kinase with a role in ion homeostasis [Sporisorium reilianum SRZ2] Length = 860 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGKVLGSGAGGTVRL Sbjct: 305 PLGEDHAHLAKKYGKWGKVLGSGAGGTVRL 334 >XP_011386487.1 hypothetical protein UMAG_00691 [Ustilago maydis 521] KIS72282.1 hypothetical protein UMAG_00691 [Ustilago maydis 521] Length = 873 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGKVLGSGAGGTVRL Sbjct: 310 PLGEDHAHLAKKYGKWGKVLGSGAGGTVRL 339 >SAM59588.1 related to HRK1-Protein kinase with a role in ion homeostasis [Ustilago bromivora] Length = 877 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGKVLGSGAGGTVRL Sbjct: 314 PLGEDHAHLAKKYGKWGKVLGSGAGGTVRL 343 >CDI51623.1 related to HRK1-Protein kinase with a role in ion homeostasis [Melanopsichium pennsylvanicum 4] Length = 877 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGKVLGSGAGGTVRL Sbjct: 305 PLGEDHAHLAKKYGKWGKVLGSGAGGTVRL 334 >CCF51180.1 related to HRK1-Protein kinase with a role in ion homeostasis [Ustilago hordei] Length = 877 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGKVLGSGAGGTVRL Sbjct: 314 PLGEDHAHLAKKYGKWGKVLGSGAGGTVRL 343 >CDW98261.1 hypothetical protein [Sporisorium scitamineum] CDU23324.1 related to HRK1-Protein kinase with a role in ion homeostasis [Sporisorium scitamineum] Length = 878 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGKVLGSGAGGTVRL Sbjct: 309 PLGEDHAHLAKKYGKWGKVLGSGAGGTVRL 338 >ETS63937.1 hypothetical protein PaG_02266 [Moesziomyces aphidis DSM 70725] Length = 1026 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGKVLGSGAGGTVRL Sbjct: 472 PLGEDHAHLAKKYGKWGKVLGSGAGGTVRL 501 >XP_014570481.1 hypothetical protein L969DRAFT_44096 [Mixia osmundae IAM 14324] GAA93636.1 hypothetical protein E5Q_00280 [Mixia osmundae IAM 14324] KEI41820.1 hypothetical protein L969DRAFT_44096 [Mixia osmundae IAM 14324] Length = 795 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 P G+ H +L+KKYGKWGKVLGSGAGGTVRL Sbjct: 278 PFGEDHAHLQKKYGKWGKVLGSGAGGTVRL 307 >CEH15821.1 pkinase-domain-containing protein [Ceraceosorus bombacis] Length = 821 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG H +L KKYGKWGKVLGSGAGGTVRL Sbjct: 297 PLGDDHAHLAKKYGKWGKVLGSGAGGTVRL 326 >KDE09044.1 HAL protein kinase [Microbotryum lychnidis-dioicae p1A1 Lamole] Length = 871 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGK+LGSGAGGTVRL Sbjct: 366 PLGEDHAHLTKKYGKWGKMLGSGAGGTVRL 395 >XP_007879109.1 hypothetical protein PFL1_03401 [Anthracocystis flocculosa PF-1] EPQ29113.1 hypothetical protein PFL1_03401 [Anthracocystis flocculosa PF-1] Length = 883 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +1 Query: 331 PLGQAHHNLRKKYGKWGKVLGSGAGGTVRL 420 PLG+ H +L KKYGKWGK LGSGAGGTVRL Sbjct: 316 PLGEDHAHLAKKYGKWGKTLGSGAGGTVRL 345 >KIJ16806.1 hypothetical protein PAXINDRAFT_74230 [Paxillus involutus ATCC 200175] Length = 414 Score = 53.9 bits (128), Expect = 1e-05 Identities = 30/52 (57%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +1 Query: 268 KTSPQPTNPVDPSMWTCSPAFPLGQAHH-NLRKKYGKWGKVLGSGAGGTVRL 420 + S P +DPS + SP L A H +L KKYGKWG+VLGSGAGGTVRL Sbjct: 34 RPSRSPPQTLDPSA-SHSPVPSLSSATHAHLSKKYGKWGRVLGSGAGGTVRL 84