BLASTX nr result
ID: Phellodendron21_contig00040306
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040306 (474 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006442391.1 hypothetical protein CICLE_v10024261mg [Citrus cl... 62 3e-08 KDO44360.1 hypothetical protein CISIN_1g000853mg [Citrus sinensis] 61 5e-08 XP_006477851.1 PREDICTED: pleiotropic drug resistance protein 3-... 61 5e-08 KDO39966.1 hypothetical protein CISIN_1g001048mg [Citrus sinensis] 61 7e-08 XP_006441094.1 hypothetical protein CICLE_v10024400mg [Citrus cl... 61 7e-08 XP_006493341.1 PREDICTED: pleiotropic drug resistance protein 3-... 61 7e-08 >XP_006442391.1 hypothetical protein CICLE_v10024261mg [Citrus clementina] ESR55631.1 hypothetical protein CICLE_v10024261mg [Citrus clementina] Length = 1395 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 204 VISRKYQAKYWHLKDYLYCYFSFDQFVTKFKAFHLGLKLDDTVS 335 VISRK Q +YWH KD+ Y Y S DQF+TKFK HLGLKL++ ++ Sbjct: 445 VISRKDQEQYWHSKDHPYSYVSMDQFITKFKTSHLGLKLEEELA 488 >KDO44360.1 hypothetical protein CISIN_1g000853mg [Citrus sinensis] Length = 1252 Score = 61.2 bits (147), Expect = 5e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 204 VISRKYQAKYWHLKDYLYCYFSFDQFVTKFKAFHLGLKLDDTVS 335 VISRK Q +YWH KD+ Y Y S DQF+TKFK HLGLKL++ ++ Sbjct: 257 VISRKDQEQYWHRKDHPYGYVSIDQFITKFKTSHLGLKLEEELA 300 >XP_006477851.1 PREDICTED: pleiotropic drug resistance protein 3-like [Citrus sinensis] Length = 1440 Score = 61.2 bits (147), Expect = 5e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 204 VISRKYQAKYWHLKDYLYCYFSFDQFVTKFKAFHLGLKLDDTVS 335 VISRK Q +YWH KD+ Y Y S DQF+TKFK HLGLKL++ ++ Sbjct: 445 VISRKDQEQYWHRKDHPYGYVSIDQFITKFKTSHLGLKLEEELA 488 >KDO39966.1 hypothetical protein CISIN_1g001048mg [Citrus sinensis] Length = 1174 Score = 60.8 bits (146), Expect = 7e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 204 VISRKYQAKYWHLKDYLYCYFSFDQFVTKFKAFHLGLKLDDTVS 335 VISRK QA+YWH +D+ Y Y S DQF+TKFKA HLGL D+ ++ Sbjct: 173 VISRKDQAQYWHCQDHPYSYVSVDQFITKFKACHLGLMQDEELA 216 >XP_006441094.1 hypothetical protein CICLE_v10024400mg [Citrus clementina] ESR54334.1 hypothetical protein CICLE_v10024400mg [Citrus clementina] Length = 1384 Score = 60.8 bits (146), Expect = 7e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 204 VISRKYQAKYWHLKDYLYCYFSFDQFVTKFKAFHLGLKLDDTVS 335 VISRK QA+YWH +D+ Y Y S DQF+TKFKA HLGL D+ ++ Sbjct: 435 VISRKDQAQYWHCQDHPYSYVSVDQFITKFKACHLGLMQDEELA 478 >XP_006493341.1 PREDICTED: pleiotropic drug resistance protein 3-like [Citrus sinensis] Length = 1442 Score = 60.8 bits (146), Expect = 7e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 204 VISRKYQAKYWHLKDYLYCYFSFDQFVTKFKAFHLGLKLDDTVS 335 VISRK QA+YWH +D+ Y Y S DQF+TKFKA HLGL D+ ++ Sbjct: 448 VISRKDQAQYWHCQDHPYSYVSVDQFITKFKACHLGLMQDEELA 491