BLASTX nr result
ID: Phellodendron21_contig00040298
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040298 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI03511.1 Nucleotide-binding, alpha-beta plait [Cynara carduncu... 57 4e-07 KNA14114.1 hypothetical protein SOVF_110620 [Spinacia oleracea] 54 5e-06 XP_010653903.1 PREDICTED: UBP1-associated protein 2A isoform X2 ... 53 5e-06 OAY43137.1 hypothetical protein MANES_08G045300 [Manihot esculenta] 53 6e-06 CAN83223.1 hypothetical protein VITISV_031367 [Vitis vinifera] 53 6e-06 GAV63942.1 RRM_1 domain-containing protein [Cephalotus follicula... 53 6e-06 XP_016738626.1 PREDICTED: UBP1-associated protein 2C-like [Gossy... 53 6e-06 XP_007028959.2 PREDICTED: UBP1-associated protein 2C isoform X2 ... 53 6e-06 OAY40581.1 hypothetical protein MANES_09G033200 [Manihot esculenta] 53 6e-06 XP_012484413.1 PREDICTED: UBP1-associated protein 2C-like [Gossy... 53 6e-06 XP_012087749.1 PREDICTED: UBP1-associated protein 2A-like [Jatro... 53 6e-06 EOY09461.1 RNA-binding family protein isoform 1 [Theobroma cacao] 53 6e-06 XP_017620973.1 PREDICTED: UBP1-associated protein 2C-like [Gossy... 53 6e-06 XP_010067463.1 PREDICTED: UBP1-associated protein 2C [Eucalyptus... 53 6e-06 XP_011004820.1 PREDICTED: UBP1-associated protein 2A-like [Popul... 53 6e-06 XP_011033238.1 PREDICTED: UBP1-associated protein 2C-like [Popul... 53 6e-06 CBI30033.3 unnamed protein product, partial [Vitis vinifera] 53 6e-06 XP_006492883.1 PREDICTED: UBP1-associated protein 2C-like [Citru... 53 6e-06 XP_002278602.1 PREDICTED: UBP1-associated protein 2C isoform X1 ... 53 6e-06 XP_007028960.2 PREDICTED: UBP1-associated protein 2A isoform X1 ... 53 6e-06 >KVI03511.1 Nucleotide-binding, alpha-beta plait [Cynara cardunculus var. scolymus] Length = 339 Score = 56.6 bits (135), Expect = 4e-07 Identities = 30/63 (47%), Positives = 40/63 (63%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCAVSVLLIVFCVQWVADVLGNTKGYKIIILENQSVRCSL 144 DP +RKLFVRGLAWNTT+ETLCAVS LL++ + A V +I++ S + Sbjct: 63 DPANRKLFVRGLAWNTTTETLCAVSALLMLVVLVLYAFVEHGEIEEGAVIIDKASGKSRG 122 Query: 143 FGF 135 +GF Sbjct: 123 YGF 125 >KNA14114.1 hypothetical protein SOVF_110620 [Spinacia oleracea] Length = 345 Score = 53.5 bits (127), Expect = 5e-06 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCAVSV 246 DPVHRKLFVRGLAWNTTSETLCA + Sbjct: 62 DPVHRKLFVRGLAWNTTSETLCAAFI 87 >XP_010653903.1 PREDICTED: UBP1-associated protein 2A isoform X2 [Vitis vinifera] Length = 265 Score = 53.1 bits (126), Expect = 5e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 74 DPVHRKLFVRGLAWNTTSETLCA 96 >OAY43137.1 hypothetical protein MANES_08G045300 [Manihot esculenta] Length = 283 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 64 DPVHRKLFVRGLAWNTTSETLCA 86 >CAN83223.1 hypothetical protein VITISV_031367 [Vitis vinifera] Length = 294 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 61 DPVHRKLFVRGLAWNTTSETLCA 83 >GAV63942.1 RRM_1 domain-containing protein [Cephalotus follicularis] Length = 333 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 66 DPVHRKLFVRGLAWNTTSETLCA 88 >XP_016738626.1 PREDICTED: UBP1-associated protein 2C-like [Gossypium hirsutum] Length = 335 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 61 DPVHRKLFVRGLAWNTTSETLCA 83 >XP_007028959.2 PREDICTED: UBP1-associated protein 2C isoform X2 [Theobroma cacao] Length = 336 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 61 DPVHRKLFVRGLAWNTTSETLCA 83 >OAY40581.1 hypothetical protein MANES_09G033200 [Manihot esculenta] Length = 336 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 62 DPVHRKLFVRGLAWNTTSETLCA 84 >XP_012484413.1 PREDICTED: UBP1-associated protein 2C-like [Gossypium raimondii] XP_016681016.1 PREDICTED: UBP1-associated protein 2C-like [Gossypium hirsutum] KJB34463.1 hypothetical protein B456_006G067200 [Gossypium raimondii] Length = 336 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 61 DPVHRKLFVRGLAWNTTSETLCA 83 >XP_012087749.1 PREDICTED: UBP1-associated protein 2A-like [Jatropha curcas] KDP24609.1 hypothetical protein JCGZ_25525 [Jatropha curcas] Length = 336 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 62 DPVHRKLFVRGLAWNTTSETLCA 84 >EOY09461.1 RNA-binding family protein isoform 1 [Theobroma cacao] Length = 336 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 61 DPVHRKLFVRGLAWNTTSETLCA 83 >XP_017620973.1 PREDICTED: UBP1-associated protein 2C-like [Gossypium arboreum] KHG11284.1 Heterogeneous nuclear ribonucleoprotein D-like protein [Gossypium arboreum] Length = 338 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 64 DPVHRKLFVRGLAWNTTSETLCA 86 >XP_010067463.1 PREDICTED: UBP1-associated protein 2C [Eucalyptus grandis] KCW65606.1 hypothetical protein EUGRSUZ_G02996 [Eucalyptus grandis] Length = 339 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 62 DPVHRKLFVRGLAWNTTSETLCA 84 >XP_011004820.1 PREDICTED: UBP1-associated protein 2A-like [Populus euphratica] Length = 340 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 64 DPVHRKLFVRGLAWNTTSETLCA 86 >XP_011033238.1 PREDICTED: UBP1-associated protein 2C-like [Populus euphratica] Length = 341 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 64 DPVHRKLFVRGLAWNTTSETLCA 86 >CBI30033.3 unnamed protein product, partial [Vitis vinifera] Length = 342 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 61 DPVHRKLFVRGLAWNTTSETLCA 83 >XP_006492883.1 PREDICTED: UBP1-associated protein 2C-like [Citrus sinensis] Length = 344 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 69 DPVHRKLFVRGLAWNTTSETLCA 91 >XP_002278602.1 PREDICTED: UBP1-associated protein 2C isoform X1 [Vitis vinifera] Length = 355 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 74 DPVHRKLFVRGLAWNTTSETLCA 96 >XP_007028960.2 PREDICTED: UBP1-associated protein 2A isoform X1 [Theobroma cacao] Length = 358 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 323 DPVHRKLFVRGLAWNTTSETLCA 255 DPVHRKLFVRGLAWNTTSETLCA Sbjct: 61 DPVHRKLFVRGLAWNTTSETLCA 83