BLASTX nr result
ID: Phellodendron21_contig00040232
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040232 (766 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH93752.1 Nucleic acid-binding, OB-fold, partial [Cynara cardun... 49 6e-06 >KVH93752.1 Nucleic acid-binding, OB-fold, partial [Cynara cardunculus var. scolymus] Length = 336 Score = 48.5 bits (114), Expect(2) = 6e-06 Identities = 23/54 (42%), Positives = 35/54 (64%) Frame = +1 Query: 172 QDSAIHAVIWNKMIPKFCPLIEEGNIYMIKNFMLEKYKEGVVYRPLFRDTRILF 333 +++ IHA IW+ ++PKF L+ EG +Y IKNF + E +RPL D +I+F Sbjct: 48 EENLIHASIWSGLVPKFRTLLHEGVLYEIKNFKVVPSVEN--FRPLANDIKIIF 99 Score = 30.0 bits (66), Expect(2) = 6e-06 Identities = 14/32 (43%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = +3 Query: 6 IIKIRVSRVWEAV-YRRTGRLMGL*LILINEQ 98 II+IR+ R+WE++ ++ G L+ L +ILI+E+ Sbjct: 17 IIRIRICRMWESLKSKKGGELISLDMILIDEE 48