BLASTX nr result
ID: Phellodendron21_contig00040182
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040182 (256 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006452983.1 hypothetical protein CICLE_v10010535mg [Citrus cl... 56 1e-08 >XP_006452983.1 hypothetical protein CICLE_v10010535mg [Citrus clementina] ESR66223.1 hypothetical protein CICLE_v10010535mg [Citrus clementina] Length = 68 Score = 55.8 bits (133), Expect = 1e-08 Identities = 31/61 (50%), Positives = 39/61 (63%) Frame = +1 Query: 19 LIMAKRIKACTD*SFVMEDSGIFQQLKVETLSIDFINCPCDYVMKNLRNGILGVAYLGLI 198 LIMAK+ + + F ++ + VETL +DFINC CDYVM+ L NGI AYLGLI Sbjct: 3 LIMAKKSRLADNELFF--NTWDVKPRVVETLPVDFINCTCDYVMEILHNGICSAAYLGLI 60 Query: 199 R 201 R Sbjct: 61 R 61