BLASTX nr result
ID: Phellodendron21_contig00040178
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040178 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007408707.1 hypothetical protein MELLADRAFT_77478 [Melampsora... 54 5e-06 >XP_007408707.1 hypothetical protein MELLADRAFT_77478 [Melampsora larici-populina 98AG31] EGG07942.1 hypothetical protein MELLADRAFT_77478 [Melampsora larici-populina 98AG31] Length = 750 Score = 54.3 bits (129), Expect = 5e-06 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -3 Query: 266 HTHDSSPYQRLPIXXXXXXXXXXXRCEDLIELQSGEKVPRYM 141 HT+DS+PYQRLP+ R EDLIELQSGEKVPRYM Sbjct: 709 HTNDSAPYQRLPMNGRRPNSNKRGRSEDLIELQSGEKVPRYM 750