BLASTX nr result
ID: Phellodendron21_contig00040112
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040112 (443 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO64922.1 hypothetical protein CISIN_1g035315mg [Citrus sinensis] 55 2e-07 >KDO64922.1 hypothetical protein CISIN_1g035315mg [Citrus sinensis] Length = 68 Score = 55.1 bits (131), Expect = 2e-07 Identities = 27/49 (55%), Positives = 30/49 (61%) Frame = -1 Query: 395 RAFSRIVF*PVLNRVILSRPMCLKFKLSPAHIYVVPCLRPLTKYVVPCR 249 RAFSR VF P+ NR +L RP CLK K AHI VPC +VPCR Sbjct: 3 RAFSRAVFWPIFNRAVLLRPACLKSKPGTAHIRAVPCRVLYRDVLVPCR 51