BLASTX nr result
ID: Phellodendron21_contig00040087
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040087 (314 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN67401.1 hypothetical protein VITISV_025967 [Vitis vinifera] 54 2e-06 >CAN67401.1 hypothetical protein VITISV_025967 [Vitis vinifera] Length = 592 Score = 54.3 bits (129), Expect = 2e-06 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -3 Query: 159 MSLVSTDFVPHHTLIIFTSQQLKPTSHSHHTATVVSCINPKSNENTNSVNPPR 1 M++ STDF PH S QLKPTSHSHHT ++V+C NP N+ NS N P+ Sbjct: 11 MTIYSTDFFPHCPPF---SPQLKPTSHSHHT-SIVTCRNPNPNDGYNSRNSPK 59