BLASTX nr result
ID: Phellodendron21_contig00040065
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00040065 (400 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNZ60739.1 hypothetical protein VP01_1507g3 [Puccinia sorghi] 67 2e-10 KNF02759.1 hypothetical protein PSTG_04045 [Puccinia striiformis... 66 6e-10 XP_003323705.2 hypothetical protein PGTG_05607 [Puccinia gramini... 63 5e-09 >KNZ60739.1 hypothetical protein VP01_1507g3 [Puccinia sorghi] Length = 759 Score = 67.0 bits (162), Expect = 2e-10 Identities = 35/73 (47%), Positives = 42/73 (57%), Gaps = 1/73 (1%) Frame = +3 Query: 183 PSPSSLATA-RTDPSPSSLATTRTISRPRAGSGRTQHPLNPISGAPPQPLQKAKGPWHKA 359 PSP LA TDP+ S + G+ R P+ PI G PP L KA+GPWHK Sbjct: 184 PSPDHLAEPPSTDPNYHSHPPPP--HKTNRGTLRVNRPIQPIDGPPPPVLHKARGPWHKD 241 Query: 360 EDISLMYWVSHLG 398 ED +L+YWVSHLG Sbjct: 242 EDTALLYWVSHLG 254 >KNF02759.1 hypothetical protein PSTG_04045 [Puccinia striiformis f. sp. tritici PST-78] Length = 773 Score = 65.9 bits (159), Expect = 6e-10 Identities = 38/98 (38%), Positives = 49/98 (50%) Frame = +3 Query: 105 PNSLQTLNYSHLGNDQLVEQRLSFTSPSPSSLATARTDPSPSSLATTRTISRPRAGSGRT 284 P+ L + HL D L P P+ ++ + SP TTR+ R Sbjct: 174 PSLLDPPSDQHLSPDHLAH-------PPPTG-HSSHSHSSPLLKTTTRSALR-------V 218 Query: 285 QHPLNPISGAPPQPLQKAKGPWHKAEDISLMYWVSHLG 398 PL PI G PP L++ KGPWHK ED +L+YWVSHLG Sbjct: 219 NRPLRPIEGPPPPVLERTKGPWHKDEDTTLLYWVSHLG 256 >XP_003323705.2 hypothetical protein PGTG_05607 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP79286.2 hypothetical protein PGTG_05607 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 979 Score = 63.2 bits (152), Expect = 5e-09 Identities = 26/43 (60%), Positives = 29/43 (67%) Frame = +3 Query: 270 GSGRTQHPLNPISGAPPQPLQKAKGPWHKAEDISLMYWVSHLG 398 G R P+ PI G PP L K KGPWHK ED +L+YWVSHLG Sbjct: 251 GGLRIHRPIQPIEGPPPPVLHKTKGPWHKDEDAALLYWVSHLG 293