BLASTX nr result
ID: Phellodendron21_contig00039995
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039995 (278 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAT74914.1 hypothetical protein VIGAN_01269200, partial [Vigna a... 54 7e-08 >BAT74914.1 hypothetical protein VIGAN_01269200, partial [Vigna angularis var. angularis] Length = 69 Score = 54.3 bits (129), Expect = 7e-08 Identities = 32/64 (50%), Positives = 39/64 (60%), Gaps = 8/64 (12%) Frame = -1 Query: 245 CNGVWRRIC-EGKMTGVK*NHFH-------KTTPSKHKIRTMMP*KINVEGLRGGASCRK 90 CNGVWRRIC E + G K + + P+KHKIRTMMP V+GL+G A CR+ Sbjct: 4 CNGVWRRICGEKEWEGRKKENGKERPKSEIQEQPTKHKIRTMMP-CFYVKGLKGKAPCRE 62 Query: 89 PAGF 78 P GF Sbjct: 63 PTGF 66