BLASTX nr result
ID: Phellodendron21_contig00039890
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039890 (379 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006440265.1 hypothetical protein CICLE_v10019196mg [Citrus cl... 61 3e-08 XP_006440264.1 hypothetical protein CICLE_v10019196mg [Citrus cl... 61 3e-08 KDO61377.1 hypothetical protein CISIN_1g0075041mg, partial [Citr... 59 7e-08 KDO61372.1 hypothetical protein CISIN_1g0075041mg, partial [Citr... 59 8e-08 XP_006477146.1 PREDICTED: peroxisomal acyl-coenzyme A oxidase 1 ... 59 1e-07 >XP_006440265.1 hypothetical protein CICLE_v10019196mg [Citrus clementina] ESR53505.1 hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 601 Score = 60.8 bits (146), Expect = 3e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 289 ARFIEKLKQDIPGKGVKPILEILCNIYALH 378 ++FIEKL+QDIPGKGVKPILEILCNIYALH Sbjct: 533 SKFIEKLQQDIPGKGVKPILEILCNIYALH 562 >XP_006440264.1 hypothetical protein CICLE_v10019196mg [Citrus clementina] ESR53504.1 hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 664 Score = 60.8 bits (146), Expect = 3e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 289 ARFIEKLKQDIPGKGVKPILEILCNIYALH 378 ++FIEKL+QDIPGKGVKPILEILCNIYALH Sbjct: 533 SKFIEKLQQDIPGKGVKPILEILCNIYALH 562 >KDO61377.1 hypothetical protein CISIN_1g0075041mg, partial [Citrus sinensis] Length = 247 Score = 58.9 bits (141), Expect = 7e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 289 ARFIEKLKQDIPGKGVKPILEILCNIYALH 378 ++FIEKL+QDIPGKGVKPILEILC+IYALH Sbjct: 179 SKFIEKLQQDIPGKGVKPILEILCHIYALH 208 >KDO61372.1 hypothetical protein CISIN_1g0075041mg, partial [Citrus sinensis] KDO61373.1 hypothetical protein CISIN_1g0075041mg, partial [Citrus sinensis] KDO61374.1 hypothetical protein CISIN_1g0075041mg, partial [Citrus sinensis] KDO61375.1 hypothetical protein CISIN_1g0075041mg, partial [Citrus sinensis] KDO61376.1 hypothetical protein CISIN_1g0075041mg, partial [Citrus sinensis] Length = 278 Score = 58.9 bits (141), Expect = 8e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 289 ARFIEKLKQDIPGKGVKPILEILCNIYALH 378 ++FIEKL+QDIPGKGVKPILEILC+IYALH Sbjct: 210 SKFIEKLQQDIPGKGVKPILEILCHIYALH 239 >XP_006477146.1 PREDICTED: peroxisomal acyl-coenzyme A oxidase 1 [Citrus sinensis] Length = 664 Score = 58.9 bits (141), Expect = 1e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 289 ARFIEKLKQDIPGKGVKPILEILCNIYALH 378 ++FIEKL+QDIPGKGVKPILEILC+IYALH Sbjct: 533 SKFIEKLQQDIPGKGVKPILEILCHIYALH 562