BLASTX nr result
ID: Phellodendron21_contig00039846
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039846 (497 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006444850.1 hypothetical protein CICLE_v100187492mg, partial ... 73 2e-12 XP_006444849.1 hypothetical protein CICLE_v10020309mg [Citrus cl... 73 4e-12 XP_006491270.1 PREDICTED: histone-lysine N-methyltransferase ATX... 73 5e-12 XP_006491269.1 PREDICTED: histone-lysine N-methyltransferase ATX... 73 5e-12 KDO86464.1 hypothetical protein CISIN_1g0367121mg, partial [Citr... 57 2e-06 >XP_006444850.1 hypothetical protein CICLE_v100187492mg, partial [Citrus clementina] XP_006444851.1 hypothetical protein CICLE_v100187492mg, partial [Citrus clementina] ESR58090.1 hypothetical protein CICLE_v100187492mg, partial [Citrus clementina] ESR58091.1 hypothetical protein CICLE_v100187492mg, partial [Citrus clementina] Length = 271 Score = 73.2 bits (178), Expect = 2e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +3 Query: 369 MIIKRPPKLEMPNPLHCKTG*SCDEDEVADEYAYVENPKKRRR 497 MIIKRP KLEMPNP CK SC+E+EVADEYAYV NPKKRRR Sbjct: 1 MIIKRPSKLEMPNPQFCKIAESCEENEVADEYAYVANPKKRRR 43 >XP_006444849.1 hypothetical protein CICLE_v10020309mg [Citrus clementina] ESR58089.1 hypothetical protein CICLE_v10020309mg [Citrus clementina] Length = 421 Score = 73.2 bits (178), Expect = 4e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +3 Query: 369 MIIKRPPKLEMPNPLHCKTG*SCDEDEVADEYAYVENPKKRRR 497 MIIKRP KLEMPNP CK SC+E+EVADEYAYV NPKKRRR Sbjct: 1 MIIKRPSKLEMPNPQFCKIAESCEENEVADEYAYVANPKKRRR 43 >XP_006491270.1 PREDICTED: histone-lysine N-methyltransferase ATX3 isoform X2 [Citrus sinensis] Length = 975 Score = 73.2 bits (178), Expect = 5e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +3 Query: 369 MIIKRPPKLEMPNPLHCKTG*SCDEDEVADEYAYVENPKKRRR 497 MIIKRP KLEMPNP CK SC+E+EVADEYAYV NPKKRRR Sbjct: 1 MIIKRPSKLEMPNPQFCKIAESCEENEVADEYAYVANPKKRRR 43 >XP_006491269.1 PREDICTED: histone-lysine N-methyltransferase ATX3 isoform X1 [Citrus sinensis] Length = 1035 Score = 73.2 bits (178), Expect = 5e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +3 Query: 369 MIIKRPPKLEMPNPLHCKTG*SCDEDEVADEYAYVENPKKRRR 497 MIIKRP KLEMPNP CK SC+E+EVADEYAYV NPKKRRR Sbjct: 1 MIIKRPSKLEMPNPQFCKIAESCEENEVADEYAYVANPKKRRR 43 >KDO86464.1 hypothetical protein CISIN_1g0367121mg, partial [Citrus sinensis] Length = 648 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 399 MPNPLHCKTG*SCDEDEVADEYAYVENPKKRRR 497 MPNP CK SC+E+EVADEYAYV NPKKRRR Sbjct: 1 MPNPQFCKIAESCEENEVADEYAYVANPKKRRR 33