BLASTX nr result
ID: Phellodendron21_contig00039753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039753 (342 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007408796.1 hypothetical protein MELLADRAFT_105415 [Melampsor... 57 3e-07 >XP_007408796.1 hypothetical protein MELLADRAFT_105415 [Melampsora larici-populina 98AG31] EGG08031.1 hypothetical protein MELLADRAFT_105415 [Melampsora larici-populina 98AG31] Length = 738 Score = 57.4 bits (137), Expect = 3e-07 Identities = 38/106 (35%), Positives = 56/106 (52%) Frame = -3 Query: 334 KRRLHGSDEPLPTYRDDQMREKVLGTIRDLTGDWDLPTSNGSPQAGKLNHRLTGLRQVIS 155 KRRLH DEPLPT+ Q E VL +++ L D LP++N + ++ L R++G Q IS Sbjct: 577 KRRLHNPDEPLPTH--GQSLETVLKSLKGLESDPTLPSTNRAKKSSNLGPRISGYLQNIS 634 Query: 154 KSNTSPRERPPAIQLVQKKSQSQGKKTAQVPNGKSGPVRKVSTFTK 17 K + + R R KK + +K N KS R+ S+ +K Sbjct: 635 KQSPTNRRRENLED--SKKRLTSNQKINSTLNSKSDWKRRASSVSK 678