BLASTX nr result
ID: Phellodendron21_contig00039746
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039746 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006435757.1 hypothetical protein CICLE_v10031403mg [Citrus cl... 55 2e-06 >XP_006435757.1 hypothetical protein CICLE_v10031403mg [Citrus clementina] XP_006486304.1 PREDICTED: protein ESKIMO 1-like isoform X1 [Citrus sinensis] ESR48997.1 hypothetical protein CICLE_v10031403mg [Citrus clementina] Length = 476 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/50 (60%), Positives = 31/50 (62%) Frame = -1 Query: 150 SRRKLFFGESQAMMKHRKXXXXXXXXXXXXXXXXXXFMYNEDVKSIAEFP 1 +RRKLFFGESQA MKHRK FMYNEDVKSIAEFP Sbjct: 4 NRRKLFFGESQATMKHRKNNNLSVFVVVFSIFLFGVFMYNEDVKSIAEFP 53