BLASTX nr result
ID: Phellodendron21_contig00039698
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039698 (270 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016756456.1 hypothetical protein SEPMUDRAFT_152024 [Sphaeruli... 65 3e-10 >XP_016756456.1 hypothetical protein SEPMUDRAFT_152024 [Sphaerulina musiva SO2202] EMF08335.1 hypothetical protein SEPMUDRAFT_152024 [Sphaerulina musiva SO2202] Length = 632 Score = 64.7 bits (156), Expect = 3e-10 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +2 Query: 2 GTAVGSDVGSRDYAPGTHTQGTHHGISSSEKTTARQPFDPYSSKGQ 139 G G+ +G++DYAPGTH QGT+ G+ ++EKTTA QP+DPYSSKGQ Sbjct: 187 GITGGTAIGAQDYAPGTHAQGTNPGL-AAEKTTASQPYDPYSSKGQ 231