BLASTX nr result
ID: Phellodendron21_contig00039693
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039693 (300 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO82220.1 hypothetical protein CISIN_1g006846mg [Citrus sinensi... 72 1e-12 XP_006483951.1 PREDICTED: BTB/POZ domain-containing protein At1g... 72 1e-12 XP_006438255.1 hypothetical protein CICLE_v10030958mg [Citrus cl... 72 1e-12 XP_002314596.2 hypothetical protein POPTR_0010s05690g [Populus t... 68 3e-11 XP_006378242.1 hypothetical protein POPTR_0010s05690g [Populus t... 68 3e-11 XP_007044812.2 PREDICTED: BTB/POZ domain-containing protein At1g... 68 3e-11 EOY00644.1 Phototropic-responsive NPH3 family protein [Theobroma... 68 3e-11 GAV63030.1 NPH3 domain-containing protein [Cephalotus follicularis] 67 7e-11 KJB50264.1 hypothetical protein B456_008G161100 [Gossypium raimo... 66 1e-10 XP_017634767.1 PREDICTED: BTB/POZ domain-containing protein At1g... 66 1e-10 XP_011045253.1 PREDICTED: BTB/POZ domain-containing protein At1g... 66 2e-10 XP_002311763.1 phototropic-responsive NPH3 family protein [Popul... 65 3e-10 XP_017618294.1 PREDICTED: BTB/POZ domain-containing protein At1g... 65 3e-10 XP_016708184.1 PREDICTED: BTB/POZ domain-containing protein At1g... 65 3e-10 XP_016666095.1 PREDICTED: BTB/POZ domain-containing protein At1g... 65 3e-10 KHG05824.1 hypothetical protein F383_32639 [Gossypium arboreum] 65 3e-10 XP_011034060.1 PREDICTED: BTB/POZ domain-containing protein At1g... 64 9e-10 XP_002530034.1 PREDICTED: BTB/POZ domain-containing protein At1g... 64 9e-10 OMO60258.1 hypothetical protein CCACVL1_24300 [Corchorus capsula... 64 1e-09 XP_008340094.1 PREDICTED: BTB/POZ domain-containing protein At1g... 63 2e-09 >KDO82220.1 hypothetical protein CISIN_1g006846mg [Citrus sinensis] KDO82221.1 hypothetical protein CISIN_1g006846mg [Citrus sinensis] Length = 629 Score = 72.0 bits (175), Expect = 1e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GRTSKFKAFCALPARPK+MFSKLLSINRSSSEKN Sbjct: 594 GMGRTSKFKAFCALPARPKKMFSKLLSINRSSSEKN 629 >XP_006483951.1 PREDICTED: BTB/POZ domain-containing protein At1g67900 [Citrus sinensis] XP_006483952.1 PREDICTED: BTB/POZ domain-containing protein At1g67900 [Citrus sinensis] Length = 629 Score = 72.0 bits (175), Expect = 1e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GRTSKFKAFCALPARPK+MFSKLLSINRSSSEKN Sbjct: 594 GMGRTSKFKAFCALPARPKKMFSKLLSINRSSSEKN 629 >XP_006438255.1 hypothetical protein CICLE_v10030958mg [Citrus clementina] XP_006438256.1 hypothetical protein CICLE_v10030958mg [Citrus clementina] XP_006438257.1 hypothetical protein CICLE_v10030958mg [Citrus clementina] ESR51495.1 hypothetical protein CICLE_v10030958mg [Citrus clementina] ESR51496.1 hypothetical protein CICLE_v10030958mg [Citrus clementina] ESR51497.1 hypothetical protein CICLE_v10030958mg [Citrus clementina] Length = 629 Score = 72.0 bits (175), Expect = 1e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GRTSKFKAFCALPARPK+MFSKLLSINRSSSEKN Sbjct: 594 GMGRTSKFKAFCALPARPKKMFSKLLSINRSSSEKN 629 >XP_002314596.2 hypothetical protein POPTR_0010s05690g [Populus trichocarpa] EEF00767.2 hypothetical protein POPTR_0010s05690g [Populus trichocarpa] Length = 622 Score = 68.2 bits (165), Expect = 3e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GR+SKFKAFCALP RPKRMFSKLLS+NR+SSEKN Sbjct: 587 GLGRSSKFKAFCALPTRPKRMFSKLLSMNRNSSEKN 622 >XP_006378242.1 hypothetical protein POPTR_0010s05690g [Populus trichocarpa] XP_002314595.2 hypothetical protein POPTR_0010s05690g [Populus trichocarpa] ERP56039.1 hypothetical protein POPTR_0010s05690g [Populus trichocarpa] EEF00766.2 hypothetical protein POPTR_0010s05690g [Populus trichocarpa] Length = 628 Score = 68.2 bits (165), Expect = 3e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GR+SKFKAFCALP RPKRMFSKLLS+NR+SSEKN Sbjct: 593 GLGRSSKFKAFCALPTRPKRMFSKLLSMNRNSSEKN 628 >XP_007044812.2 PREDICTED: BTB/POZ domain-containing protein At1g67900 [Theobroma cacao] Length = 632 Score = 68.2 bits (165), Expect = 3e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GR SKFKAFCALPARPK+MFSKLLSINRS SEKN Sbjct: 597 GMGRPSKFKAFCALPARPKKMFSKLLSINRSGSEKN 632 >EOY00644.1 Phototropic-responsive NPH3 family protein [Theobroma cacao] Length = 632 Score = 68.2 bits (165), Expect = 3e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GR SKFKAFCALPARPK+MFSKLLSINRS SEKN Sbjct: 597 GMGRPSKFKAFCALPARPKKMFSKLLSINRSGSEKN 632 >GAV63030.1 NPH3 domain-containing protein [Cephalotus follicularis] Length = 626 Score = 67.0 bits (162), Expect = 7e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 GIGRTS+FKAFCALP RPK+MFSKLL INRS+SEKN Sbjct: 591 GIGRTSRFKAFCALPTRPKKMFSKLLFINRSASEKN 626 >KJB50264.1 hypothetical protein B456_008G161100 [Gossypium raimondii] Length = 512 Score = 66.2 bits (160), Expect = 1e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GR SKFKAFCALP RPKRMF+KLLSINRS SEKN Sbjct: 477 GMGRPSKFKAFCALPRRPKRMFNKLLSINRSGSEKN 512 >XP_017634767.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium arboreum] XP_017634768.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium arboreum] XP_017634769.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium arboreum] XP_017634770.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium arboreum] XP_017634771.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium arboreum] KHG03539.1 hypothetical protein F383_27138 [Gossypium arboreum] Length = 632 Score = 66.2 bits (160), Expect = 1e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GR SKFKAFCALP RPKRMF+KLLSINRS SEKN Sbjct: 597 GMGRPSKFKAFCALPRRPKRMFNKLLSINRSGSEKN 632 >XP_011045253.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like isoform X1 [Populus euphratica] Length = 628 Score = 65.9 bits (159), Expect = 2e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GR+SK KAFCALP RPKRMFSKLLS+NR+SSEKN Sbjct: 593 GLGRSSKLKAFCALPTRPKRMFSKLLSMNRNSSEKN 628 >XP_002311763.1 phototropic-responsive NPH3 family protein [Populus trichocarpa] EEE89130.1 phototropic-responsive NPH3 family protein [Populus trichocarpa] Length = 628 Score = 65.1 bits (157), Expect = 3e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+ RTSKFK+FCALP RPKRMFSK LSINR+SSEKN Sbjct: 593 GLRRTSKFKSFCALPTRPKRMFSKFLSINRNSSEKN 628 >XP_017618294.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium arboreum] XP_017618300.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium arboreum] XP_017618307.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium arboreum] XP_017618314.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium arboreum] XP_017618322.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium arboreum] XP_017618330.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium arboreum] XP_017618336.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium arboreum] Length = 629 Score = 65.1 bits (157), Expect = 3e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GR+SKFKAFCALP PK+MFSKLLSINRS SEKN Sbjct: 594 GLGRSSKFKAFCALPTGPKKMFSKLLSINRSGSEKN 629 >XP_016708184.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium hirsutum] Length = 629 Score = 65.1 bits (157), Expect = 3e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GR+SKFKAFCALP PK+MFSKLLSINRS SEKN Sbjct: 594 GLGRSSKFKAFCALPTGPKKMFSKLLSINRSGSEKN 629 >XP_016666095.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium hirsutum] XP_016666096.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium hirsutum] XP_016666098.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium hirsutum] XP_016666099.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium hirsutum] XP_016666100.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium hirsutum] XP_016666101.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Gossypium hirsutum] Length = 629 Score = 65.1 bits (157), Expect = 3e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GR+SKFKAFCALP PK+MFSKLLSINRS SEKN Sbjct: 594 GLGRSSKFKAFCALPTGPKKMFSKLLSINRSGSEKN 629 >KHG05824.1 hypothetical protein F383_32639 [Gossypium arboreum] Length = 629 Score = 65.1 bits (157), Expect = 3e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+GR+SKFKAFCALP PK+MFSKLLSINRS SEKN Sbjct: 594 GLGRSSKFKAFCALPTGPKKMFSKLLSINRSGSEKN 629 >XP_011034060.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Populus euphratica] XP_011034061.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Populus euphratica] XP_011034062.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Populus euphratica] XP_011034063.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Populus euphratica] Length = 628 Score = 63.9 bits (154), Expect = 9e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 G+ RTSKFK+FCALP RPKRMFSK LSINR++SEKN Sbjct: 593 GLRRTSKFKSFCALPTRPKRMFSKFLSINRNTSEKN 628 >XP_002530034.1 PREDICTED: BTB/POZ domain-containing protein At1g67900 [Ricinus communis] EEF32334.1 signal transducer, putative [Ricinus communis] Length = 631 Score = 63.9 bits (154), Expect = 9e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 GIGRTSKFKAF LP RPKRMFSKLLSINRS+ EKN Sbjct: 596 GIGRTSKFKAFRTLPTRPKRMFSKLLSINRSAGEKN 631 >OMO60258.1 hypothetical protein CCACVL1_24300 [Corchorus capsularis] Length = 635 Score = 63.5 bits (153), Expect = 1e-09 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 2/38 (5%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRS--SSEKN 144 G+GR SKFKAFCALPARPK+MFSKLLS+NRS SSEKN Sbjct: 598 GMGRPSKFKAFCALPARPKKMFSKLLSMNRSTPSSEKN 635 >XP_008340094.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Malus domestica] XP_008340095.1 PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Malus domestica] Length = 632 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 37 GIGRTSKFKAFCALPARPKRMFSKLLSINRSSSEKN 144 GIGR SKFK+ C+LPA+PKRMFSKL SINR+SSEKN Sbjct: 597 GIGRNSKFKSLCSLPAKPKRMFSKLWSINRTSSEKN 632