BLASTX nr result
ID: Phellodendron21_contig00039659
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039659 (318 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015385399.1 PREDICTED: kinesin-4 isoform X2 [Citrus sinensis] 77 3e-14 KDO76229.1 hypothetical protein CISIN_1g001464mg [Citrus sinensis] 77 3e-14 KDO76228.1 hypothetical protein CISIN_1g001464mg [Citrus sinensis] 77 3e-14 XP_006439545.1 hypothetical protein CICLE_v10018623mg [Citrus cl... 77 3e-14 KDO76227.1 hypothetical protein CISIN_1g001464mg [Citrus sinensis] 77 3e-14 XP_006476565.1 PREDICTED: kinesin-4 isoform X1 [Citrus sinensis]... 77 3e-14 XP_006439546.1 hypothetical protein CICLE_v10018623mg [Citrus cl... 77 3e-14 >XP_015385399.1 PREDICTED: kinesin-4 isoform X2 [Citrus sinensis] Length = 1019 Score = 77.0 bits (188), Expect = 3e-14 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = -2 Query: 161 MELDENGVFDRSNGTPAEIADNVEGFENMAEAEGNQLSTLVEWLNDMMPHLHL 3 ME DENGVFD S GTPAE N+E +NMAE GNQLSTLVEWLN+M+PH+HL Sbjct: 1 MESDENGVFDHSTGTPAE---NIEALDNMAE--GNQLSTLVEWLNEMIPHIHL 48 >KDO76229.1 hypothetical protein CISIN_1g001464mg [Citrus sinensis] Length = 1019 Score = 77.0 bits (188), Expect = 3e-14 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = -2 Query: 161 MELDENGVFDRSNGTPAEIADNVEGFENMAEAEGNQLSTLVEWLNDMMPHLHL 3 ME DENGVFD S GTPAE N+E +NMAE GNQLSTLVEWLN+M+PH+HL Sbjct: 1 MESDENGVFDHSTGTPAE---NIEALDNMAE--GNQLSTLVEWLNEMIPHIHL 48 >KDO76228.1 hypothetical protein CISIN_1g001464mg [Citrus sinensis] Length = 1055 Score = 77.0 bits (188), Expect = 3e-14 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = -2 Query: 161 MELDENGVFDRSNGTPAEIADNVEGFENMAEAEGNQLSTLVEWLNDMMPHLHL 3 ME DENGVFD S GTPAE N+E +NMAE GNQLSTLVEWLN+M+PH+HL Sbjct: 1 MESDENGVFDHSTGTPAE---NIEALDNMAE--GNQLSTLVEWLNEMIPHIHL 48 >XP_006439545.1 hypothetical protein CICLE_v10018623mg [Citrus clementina] ESR52785.1 hypothetical protein CICLE_v10018623mg [Citrus clementina] Length = 1070 Score = 77.0 bits (188), Expect = 3e-14 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = -2 Query: 161 MELDENGVFDRSNGTPAEIADNVEGFENMAEAEGNQLSTLVEWLNDMMPHLHL 3 ME DENGVFD S GTPAE N+E +NMAE GNQLSTLVEWLN+M+PH+HL Sbjct: 1 MESDENGVFDHSTGTPAE---NIEALDNMAE--GNQLSTLVEWLNEMIPHIHL 48 >KDO76227.1 hypothetical protein CISIN_1g001464mg [Citrus sinensis] Length = 1073 Score = 77.0 bits (188), Expect = 3e-14 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = -2 Query: 161 MELDENGVFDRSNGTPAEIADNVEGFENMAEAEGNQLSTLVEWLNDMMPHLHL 3 ME DENGVFD S GTPAE N+E +NMAE GNQLSTLVEWLN+M+PH+HL Sbjct: 1 MESDENGVFDHSTGTPAE---NIEALDNMAE--GNQLSTLVEWLNEMIPHIHL 48 >XP_006476565.1 PREDICTED: kinesin-4 isoform X1 [Citrus sinensis] XP_006476566.1 PREDICTED: kinesin-4 isoform X1 [Citrus sinensis] Length = 1073 Score = 77.0 bits (188), Expect = 3e-14 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = -2 Query: 161 MELDENGVFDRSNGTPAEIADNVEGFENMAEAEGNQLSTLVEWLNDMMPHLHL 3 ME DENGVFD S GTPAE N+E +NMAE GNQLSTLVEWLN+M+PH+HL Sbjct: 1 MESDENGVFDHSTGTPAE---NIEALDNMAE--GNQLSTLVEWLNEMIPHIHL 48 >XP_006439546.1 hypothetical protein CICLE_v10018623mg [Citrus clementina] ESR52786.1 hypothetical protein CICLE_v10018623mg [Citrus clementina] Length = 1074 Score = 77.0 bits (188), Expect = 3e-14 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = -2 Query: 161 MELDENGVFDRSNGTPAEIADNVEGFENMAEAEGNQLSTLVEWLNDMMPHLHL 3 ME DENGVFD S GTPAE N+E +NMAE GNQLSTLVEWLN+M+PH+HL Sbjct: 1 MESDENGVFDHSTGTPAE---NIEALDNMAE--GNQLSTLVEWLNEMIPHIHL 48