BLASTX nr result
ID: Phellodendron21_contig00039607
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039607 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KCW53781.1 hypothetical protein EUGRSUZ_J03029 [Eucalyptus grandis] 70 1e-11 XP_011466727.1 PREDICTED: uncharacterized protein LOC101300839 [... 70 2e-11 XP_008228627.1 PREDICTED: titin homolog [Prunus mume] 70 2e-11 XP_007217019.1 hypothetical protein PRUPE_ppa002010mg [Prunus pe... 70 2e-11 XP_018827379.1 PREDICTED: trichohyalin [Juglans regia] 70 2e-11 XP_006465511.1 PREDICTED: trichohyalin [Citrus sinensis] 70 2e-11 XP_015872226.1 PREDICTED: uncharacterized protein LOC107409301 [... 70 2e-11 XP_010033909.1 PREDICTED: myosin heavy chain, muscle [Eucalyptus... 70 2e-11 CBI36233.3 unnamed protein product, partial [Vitis vinifera] 68 7e-11 KDO58236.1 hypothetical protein CISIN_1g047330mg, partial [Citru... 68 7e-11 XP_006427148.1 hypothetical protein CICLE_v10024977mg [Citrus cl... 68 7e-11 XP_010654724.1 PREDICTED: uncharacterized protein LOC100251511 [... 68 7e-11 GAV69179.1 hypothetical protein CFOL_v3_12680 [Cephalotus follic... 68 9e-11 EYU31948.1 hypothetical protein MIMGU_mgv1a0032682mg, partial [E... 67 2e-10 KJB13111.1 hypothetical protein B456_002G057500 [Gossypium raimo... 67 2e-10 XP_016739752.1 PREDICTED: uncharacterized protein LOC107949566 [... 67 2e-10 XP_012843927.1 PREDICTED: uncharacterized protein LOC105963972 [... 67 2e-10 XP_016742532.1 PREDICTED: synaptonemal complex protein 1-like is... 67 2e-10 XP_011012299.1 PREDICTED: plectin-like [Populus euphratica] 67 2e-10 KJB13112.1 hypothetical protein B456_002G057500 [Gossypium raimo... 67 2e-10 >KCW53781.1 hypothetical protein EUGRSUZ_J03029 [Eucalyptus grandis] Length = 725 Score = 70.5 bits (171), Expect = 1e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +2 Query: 2 RNASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 +NA FDPA+IRVDPYGNVLYYH DSASPLAWDID Sbjct: 66 KNAGFDPAVIRVDPYGNVLYYHADSASPLAWDID 99 >XP_011466727.1 PREDICTED: uncharacterized protein LOC101300839 [Fragaria vesca subsp. vesca] Length = 730 Score = 69.7 bits (169), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDPA+IRVDPYGNVLYYH DSASPLAWDID Sbjct: 93 NAGFDPAVIRVDPYGNVLYYHADSASPLAWDID 125 >XP_008228627.1 PREDICTED: titin homolog [Prunus mume] Length = 730 Score = 69.7 bits (169), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDPA+IRVDPYGNVLYYH DSASPLAWDID Sbjct: 93 NAGFDPAVIRVDPYGNVLYYHADSASPLAWDID 125 >XP_007217019.1 hypothetical protein PRUPE_ppa002010mg [Prunus persica] ONI16069.1 hypothetical protein PRUPE_3G077300 [Prunus persica] Length = 730 Score = 69.7 bits (169), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDPA+IRVDPYGNVLYYH DSASPLAWDID Sbjct: 93 NAGFDPAVIRVDPYGNVLYYHADSASPLAWDID 125 >XP_018827379.1 PREDICTED: trichohyalin [Juglans regia] Length = 735 Score = 69.7 bits (169), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDPA+IRVDPYGNVLYYH DSASPLAWDID Sbjct: 93 NAGFDPAVIRVDPYGNVLYYHADSASPLAWDID 125 >XP_006465511.1 PREDICTED: trichohyalin [Citrus sinensis] Length = 745 Score = 69.7 bits (169), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDPA+IRVDPYGNVLYYH DSASPLAWDID Sbjct: 96 NAGFDPAVIRVDPYGNVLYYHADSASPLAWDID 128 >XP_015872226.1 PREDICTED: uncharacterized protein LOC107409301 [Ziziphus jujuba] Length = 746 Score = 69.7 bits (169), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDPA+IRVDPYGNVLYYH DSASPLAWDID Sbjct: 94 NAGFDPAVIRVDPYGNVLYYHADSASPLAWDID 126 >XP_010033909.1 PREDICTED: myosin heavy chain, muscle [Eucalyptus grandis] Length = 751 Score = 69.7 bits (169), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDPA+IRVDPYGNVLYYH DSASPLAWDID Sbjct: 93 NAGFDPAVIRVDPYGNVLYYHADSASPLAWDID 125 >CBI36233.3 unnamed protein product, partial [Vitis vinifera] Length = 657 Score = 68.2 bits (165), Expect = 7e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDPA+ RVDPYGNVLYYH DSASPLAWDID Sbjct: 93 NAGFDPAIFRVDPYGNVLYYHADSASPLAWDID 125 >KDO58236.1 hypothetical protein CISIN_1g047330mg, partial [Citrus sinensis] Length = 721 Score = 68.2 bits (165), Expect = 7e-11 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDPA+IRVDPYGNVLYYH DSASPLAW+ID Sbjct: 96 NAGFDPAVIRVDPYGNVLYYHADSASPLAWEID 128 >XP_006427148.1 hypothetical protein CICLE_v10024977mg [Citrus clementina] ESR40388.1 hypothetical protein CICLE_v10024977mg [Citrus clementina] Length = 745 Score = 68.2 bits (165), Expect = 7e-11 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDPA+IRVDPYGNVLYYH DSASPLAW+ID Sbjct: 96 NAGFDPAVIRVDPYGNVLYYHADSASPLAWEID 128 >XP_010654724.1 PREDICTED: uncharacterized protein LOC100251511 [Vitis vinifera] Length = 753 Score = 68.2 bits (165), Expect = 7e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDPA+ RVDPYGNVLYYH DSASPLAWDID Sbjct: 93 NAGFDPAIFRVDPYGNVLYYHADSASPLAWDID 125 >GAV69179.1 hypothetical protein CFOL_v3_12680 [Cephalotus follicularis] Length = 769 Score = 67.8 bits (164), Expect = 9e-11 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDPA+IR+DPYGNVLYYH DSASPLAWD D Sbjct: 93 NAGFDPAVIRIDPYGNVLYYHADSASPLAWDFD 125 >EYU31948.1 hypothetical protein MIMGU_mgv1a0032682mg, partial [Erythranthe guttata] Length = 311 Score = 66.6 bits (161), Expect = 2e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDP +IRVDPYGNVLYYH D+ASPLAWDID Sbjct: 93 NAGFDPEIIRVDPYGNVLYYHADAASPLAWDID 125 >KJB13111.1 hypothetical protein B456_002G057500 [Gossypium raimondii] Length = 509 Score = 66.6 bits (161), Expect = 2e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDP +IRVDPYGNVLYYH DSASPL+WDID Sbjct: 93 NAGFDPEVIRVDPYGNVLYYHADSASPLSWDID 125 >XP_016739752.1 PREDICTED: uncharacterized protein LOC107949566 [Gossypium hirsutum] Length = 600 Score = 66.6 bits (161), Expect = 2e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDP +IRVDPYGNVLYYH DSASPL+WDID Sbjct: 93 NAGFDPEVIRVDPYGNVLYYHADSASPLSWDID 125 >XP_012843927.1 PREDICTED: uncharacterized protein LOC105963972 [Erythranthe guttata] Length = 601 Score = 66.6 bits (161), Expect = 2e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDP +IRVDPYGNVLYYH D+ASPLAWDID Sbjct: 93 NAGFDPEIIRVDPYGNVLYYHADAASPLAWDID 125 >XP_016742532.1 PREDICTED: synaptonemal complex protein 1-like isoform X2 [Gossypium hirsutum] Length = 666 Score = 66.6 bits (161), Expect = 2e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDP +IRVDPYGNVLYYH DSASPL+WDID Sbjct: 93 NAGFDPEVIRVDPYGNVLYYHADSASPLSWDID 125 >XP_011012299.1 PREDICTED: plectin-like [Populus euphratica] Length = 680 Score = 66.6 bits (161), Expect = 2e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDPA+IRVDPYGNVLY+H D ASPLAWDID Sbjct: 94 NAGFDPAVIRVDPYGNVLYFHADKASPLAWDID 126 >KJB13112.1 hypothetical protein B456_002G057500 [Gossypium raimondii] Length = 696 Score = 66.6 bits (161), Expect = 2e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 5 NASFDPAMIRVDPYGNVLYYHVDSASPLAWDID 103 NA FDP +IRVDPYGNVLYYH DSASPL+WDID Sbjct: 93 NAGFDPEVIRVDPYGNVLYYHADSASPLSWDID 125