BLASTX nr result
ID: Phellodendron21_contig00039606
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039606 (427 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OBW68918.1 Uncharacterized protein AUREO_010320 [Aureobasidium p... 61 4e-08 KEQ89565.1 WSC-domain-containing protein [Aureobasidium pullulan... 61 4e-08 XP_013345250.1 hypothetical protein AUEXF2481DRAFT_3647 [Aureoba... 59 2e-07 KEQ66750.1 hypothetical protein M437DRAFT_81227 [Aureobasidium m... 59 2e-07 GAM87336.1 hypothetical protein ANO11243_053590 [fungal sp. No.1... 59 2e-07 XP_013425165.1 WSC-domain-containing protein [Aureobasidium nami... 57 9e-07 >OBW68918.1 Uncharacterized protein AUREO_010320 [Aureobasidium pullulans] Length = 445 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +2 Query: 2 ALMENLDHNGSRTSINTMQDQRDYSRPLNVINPDP 106 ALMEN + NGSR SI TMQDQRDYSRPL V NPDP Sbjct: 408 ALMENWERNGSRASIGTMQDQRDYSRPLGVTNPDP 442 >KEQ89565.1 WSC-domain-containing protein [Aureobasidium pullulans EXF-150] Length = 445 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +2 Query: 2 ALMENLDHNGSRTSINTMQDQRDYSRPLNVINPDP 106 ALMEN + NGSR SI TMQDQRDYSRPL V NPDP Sbjct: 408 ALMENWERNGSRASIGTMQDQRDYSRPLGVTNPDP 442 >XP_013345250.1 hypothetical protein AUEXF2481DRAFT_3647 [Aureobasidium subglaciale EXF-2481] KEQ96967.1 hypothetical protein AUEXF2481DRAFT_3647 [Aureobasidium subglaciale EXF-2481] Length = 429 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 2 ALMENLDHNGSRTSINTMQDQRDYSRPLNVINPDP 106 ALME+ + NGSR SI TMQDQRDYSRPL V NPDP Sbjct: 392 ALMEHWERNGSRASIGTMQDQRDYSRPLGVTNPDP 426 >KEQ66750.1 hypothetical protein M437DRAFT_81227 [Aureobasidium melanogenum CBS 110374] Length = 448 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 2 ALMENLDHNGSRTSINTMQDQRDYSRPLNVINPDP 106 ALME+ + NGSR SI TMQDQRDYSRPL V NPDP Sbjct: 411 ALMEHWERNGSRASIGTMQDQRDYSRPLGVTNPDP 445 >GAM87336.1 hypothetical protein ANO11243_053590 [fungal sp. No.11243] Length = 345 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 2 ALMENLDHNGSRTSINTMQDQRDYSRPLNVINPD 103 ALMEN NGSR+S+NTMQDQRDYSRPL + NPD Sbjct: 308 ALMENWQMNGSRSSVNTMQDQRDYSRPLGITNPD 341 >XP_013425165.1 WSC-domain-containing protein [Aureobasidium namibiae CBS 147.97] KEQ71071.1 WSC-domain-containing protein [Aureobasidium namibiae CBS 147.97] Length = 444 Score = 57.0 bits (136), Expect = 9e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 2 ALMENLDHNGSRTSINTMQDQRDYSRPLNVINPDP 106 ALM++ + NGSR SI TMQDQRDYSRPL V NPDP Sbjct: 407 ALMQHWEMNGSRASIGTMQDQRDYSRPLGVTNPDP 441