BLASTX nr result
ID: Phellodendron21_contig00039566
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039566 (298 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAV93217.1 hypothetical protein PTTG_12308 [Puccinia triticina 1... 54 3e-06 KNF03982.1 hypothetical protein PSTG_03063 [Puccinia striiformis... 53 4e-06 XP_003325354.1 hypothetical protein PGTG_07187 [Puccinia gramini... 53 5e-06 >OAV93217.1 hypothetical protein PTTG_12308 [Puccinia triticina 1-1 BBBD Race 1] Length = 308 Score = 53.5 bits (127), Expect = 3e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -2 Query: 297 RLALEDGGMAGFRKRGARADGSVPTDSETFYRRYDYSNNS 178 RL LE G F+KRGA + SVPTDSE FYR+YDYSN++ Sbjct: 269 RLKLEAQGDPHFKKRGALPESSVPTDSEVFYRKYDYSNSA 308 >KNF03982.1 hypothetical protein PSTG_03063 [Puccinia striiformis f. sp. tritici PST-78] Length = 245 Score = 53.1 bits (126), Expect = 4e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -2 Query: 297 RLALEDGGMAGFRKRGARADGSVPTDSETFYRRYDYSNNS 178 RL LE G F+KRGA + SVPTDSE FYR+YDY+N++ Sbjct: 206 RLKLEAEGDPAFKKRGALPESSVPTDSEVFYRKYDYTNSA 245 >XP_003325354.1 hypothetical protein PGTG_07187 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP80935.1 hypothetical protein PGTG_07187 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 312 Score = 53.1 bits (126), Expect = 5e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -2 Query: 297 RLALEDGGMAGFRKRGARADGSVPTDSETFYRRYDYSNNS 178 RL LE G F+KRGA + SVPTDSE FYR+YDY+N++ Sbjct: 273 RLKLEAQGDPAFKKRGALPESSVPTDSEVFYRKYDYTNSA 312