BLASTX nr result
ID: Phellodendron21_contig00039530
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039530 (342 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006444185.1 hypothetical protein CICLE_v10019759mg [Citrus cl... 76 7e-14 >XP_006444185.1 hypothetical protein CICLE_v10019759mg [Citrus clementina] XP_006444186.1 hypothetical protein CICLE_v10019759mg [Citrus clementina] XP_006479827.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Citrus sinensis] ESR57425.1 hypothetical protein CICLE_v10019759mg [Citrus clementina] ESR57426.1 hypothetical protein CICLE_v10019759mg [Citrus clementina] KDO87451.1 hypothetical protein CISIN_1g010292mg [Citrus sinensis] KDO87452.1 hypothetical protein CISIN_1g010292mg [Citrus sinensis] KDO87453.1 hypothetical protein CISIN_1g010292mg [Citrus sinensis] Length = 513 Score = 76.3 bits (186), Expect = 7e-14 Identities = 38/55 (69%), Positives = 46/55 (83%), Gaps = 2/55 (3%) Frame = +2 Query: 167 MNRVSKLSNAAQSELL--RFPRHYTKPKTLPQLSIFTLTKSPNYNFIREICAPAT 325 M RV KLS+AAQ+ELL R RH +KPKTLP LS+FTLTKSPN++F R++CAPAT Sbjct: 1 MKRVWKLSDAAQTELLLQRLQRHSSKPKTLPPLSVFTLTKSPNHSFTRDLCAPAT 55