BLASTX nr result
ID: Phellodendron21_contig00039489
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039489 (503 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO36552.1 hypothetical protein CISIN_1g045468mg, partial [Citru... 74 4e-13 XP_016731095.1 PREDICTED: ribonuclease J-like [Gossypium hirsutu... 74 3e-12 XP_006477011.1 PREDICTED: ribonuclease J isoform X2 [Citrus sine... 74 3e-12 XP_017610830.1 PREDICTED: ribonuclease J-like isoform X2 [Gossyp... 74 3e-12 XP_016730049.1 PREDICTED: ribonuclease J-like isoform X2 [Gossyp... 74 3e-12 XP_012468135.1 PREDICTED: uncharacterized protein LOC105786301 [... 74 3e-12 XP_017610820.1 PREDICTED: ribonuclease J-like isoform X1 [Gossyp... 74 3e-12 XP_016730048.1 PREDICTED: ribonuclease J-like isoform X1 [Gossyp... 74 3e-12 XP_006477010.1 PREDICTED: ribonuclease J isoform X1 [Citrus sine... 74 3e-12 XP_006440090.1 hypothetical protein CICLE_v10018763mg [Citrus cl... 74 3e-12 XP_007210499.1 hypothetical protein PRUPE_ppa001238mg [Prunus pe... 73 5e-12 ONI08003.1 hypothetical protein PRUPE_5G152800 [Prunus persica] 73 5e-12 KJB19807.1 hypothetical protein B456_003G119600 [Gossypium raimo... 73 6e-12 XP_012471116.1 PREDICTED: uncharacterized protein LOC105788673 i... 73 6e-12 XP_017616144.1 PREDICTED: ribonuclease J-like isoform X4 [Gossyp... 73 6e-12 XP_016665596.1 PREDICTED: ribonuclease J-like isoform X3 [Gossyp... 73 6e-12 XP_012471117.1 PREDICTED: uncharacterized protein LOC105788673 i... 73 6e-12 XP_017616143.1 PREDICTED: ribonuclease J-like isoform X3 [Gossyp... 73 6e-12 XP_017973853.1 PREDICTED: ribonuclease J isoform X2 [Theobroma c... 73 6e-12 ONI08004.1 hypothetical protein PRUPE_5G152800 [Prunus persica] 73 7e-12 >KDO36552.1 hypothetical protein CISIN_1g045468mg, partial [Citrus sinensis] Length = 221 Score = 73.9 bits (180), Expect = 4e-13 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMGRNEGLHT GHGYRGEL VL Sbjct: 147 ESRVMKMLNRISEIGSTIVMGRNEGLHTSGHGYRGELEEVL 187 >XP_016731095.1 PREDICTED: ribonuclease J-like [Gossypium hirsutum] XP_016731096.1 PREDICTED: ribonuclease J-like [Gossypium hirsutum] Length = 714 Score = 73.9 bits (180), Expect = 3e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMGRNEGLHT GHGYRGEL VL Sbjct: 239 ESRVMKMLNRISEIGSTIVMGRNEGLHTSGHGYRGELEEVL 279 >XP_006477011.1 PREDICTED: ribonuclease J isoform X2 [Citrus sinensis] Length = 734 Score = 73.9 bits (180), Expect = 3e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMGRNEGLHT GHGYRGEL VL Sbjct: 263 ESRVMKMLNRISEIGSTIVMGRNEGLHTSGHGYRGELEEVL 303 >XP_017610830.1 PREDICTED: ribonuclease J-like isoform X2 [Gossypium arboreum] Length = 738 Score = 73.9 bits (180), Expect = 3e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMGRNEGLHT GHGYRGEL VL Sbjct: 263 ESRVMKMLNRISEIGSTIVMGRNEGLHTSGHGYRGELEEVL 303 >XP_016730049.1 PREDICTED: ribonuclease J-like isoform X2 [Gossypium hirsutum] Length = 740 Score = 73.9 bits (180), Expect = 3e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMGRNEGLHT GHGYRGEL VL Sbjct: 263 ESRVMKMLNRISEIGSTIVMGRNEGLHTSGHGYRGELEEVL 303 >XP_012468135.1 PREDICTED: uncharacterized protein LOC105786301 [Gossypium raimondii] XP_012468148.1 PREDICTED: uncharacterized protein LOC105786301 [Gossypium raimondii] KJB08022.1 hypothetical protein B456_001G059600 [Gossypium raimondii] KJB08023.1 hypothetical protein B456_001G059600 [Gossypium raimondii] KJB08024.1 hypothetical protein B456_001G059600 [Gossypium raimondii] Length = 884 Score = 73.9 bits (180), Expect = 3e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMGRNEGLHT GHGYRGEL VL Sbjct: 409 ESRVMKMLNRISEIGSTIVMGRNEGLHTSGHGYRGELEEVL 449 >XP_017610820.1 PREDICTED: ribonuclease J-like isoform X1 [Gossypium arboreum] KHG17441.1 Ribonuclease J [Gossypium arboreum] Length = 884 Score = 73.9 bits (180), Expect = 3e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMGRNEGLHT GHGYRGEL VL Sbjct: 409 ESRVMKMLNRISEIGSTIVMGRNEGLHTSGHGYRGELEEVL 449 >XP_016730048.1 PREDICTED: ribonuclease J-like isoform X1 [Gossypium hirsutum] Length = 886 Score = 73.9 bits (180), Expect = 3e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMGRNEGLHT GHGYRGEL VL Sbjct: 409 ESRVMKMLNRISEIGSTIVMGRNEGLHTSGHGYRGELEEVL 449 >XP_006477010.1 PREDICTED: ribonuclease J isoform X1 [Citrus sinensis] Length = 912 Score = 73.9 bits (180), Expect = 3e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMGRNEGLHT GHGYRGEL VL Sbjct: 441 ESRVMKMLNRISEIGSTIVMGRNEGLHTSGHGYRGELEEVL 481 >XP_006440090.1 hypothetical protein CICLE_v10018763mg [Citrus clementina] ESR53330.1 hypothetical protein CICLE_v10018763mg [Citrus clementina] Length = 912 Score = 73.9 bits (180), Expect = 3e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMGRNEGLHT GHGYRGEL VL Sbjct: 441 ESRVMKMLNRISEIGSTIVMGRNEGLHTSGHGYRGELEEVL 481 >XP_007210499.1 hypothetical protein PRUPE_ppa001238mg [Prunus persica] Length = 875 Score = 73.2 bits (178), Expect = 5e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMG+NEGLHT GHGYRGEL VL Sbjct: 407 ESRVMKMLNRISEIGSTIVMGKNEGLHTSGHGYRGELVKVL 447 >ONI08003.1 hypothetical protein PRUPE_5G152800 [Prunus persica] Length = 902 Score = 73.2 bits (178), Expect = 5e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMG+NEGLHT GHGYRGEL VL Sbjct: 434 ESRVMKMLNRISEIGSTIVMGKNEGLHTSGHGYRGELVKVL 474 >KJB19807.1 hypothetical protein B456_003G119600 [Gossypium raimondii] Length = 622 Score = 72.8 bits (177), Expect = 6e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMG+NEGLHT GHGYRGEL VL Sbjct: 171 ESRVMKMLNRISEIGSTIVMGKNEGLHTSGHGYRGELEEVL 211 >XP_012471116.1 PREDICTED: uncharacterized protein LOC105788673 isoform X3 [Gossypium raimondii] Length = 706 Score = 72.8 bits (177), Expect = 6e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMG+NEGLHT GHGYRGEL VL Sbjct: 409 ESRVMKMLNRISEIGSTIVMGKNEGLHTSGHGYRGELEEVL 449 >XP_017616144.1 PREDICTED: ribonuclease J-like isoform X4 [Gossypium arboreum] Length = 712 Score = 72.8 bits (177), Expect = 6e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMG+NEGLHT GHGYRGEL VL Sbjct: 261 ESRVMKMLNRISEIGSTIVMGKNEGLHTSGHGYRGELEEVL 301 >XP_016665596.1 PREDICTED: ribonuclease J-like isoform X3 [Gossypium hirsutum] Length = 712 Score = 72.8 bits (177), Expect = 6e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMG+NEGLHT GHGYRGEL VL Sbjct: 261 ESRVMKMLNRISEIGSTIVMGKNEGLHTSGHGYRGELEEVL 301 >XP_012471117.1 PREDICTED: uncharacterized protein LOC105788673 isoform X4 [Gossypium raimondii] Length = 712 Score = 72.8 bits (177), Expect = 6e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMG+NEGLHT GHGYRGEL VL Sbjct: 261 ESRVMKMLNRISEIGSTIVMGKNEGLHTSGHGYRGELEEVL 301 >XP_017616143.1 PREDICTED: ribonuclease J-like isoform X3 [Gossypium arboreum] Length = 732 Score = 72.8 bits (177), Expect = 6e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMG+NEGLHT GHGYRGEL VL Sbjct: 281 ESRVMKMLNRISEIGSTIVMGKNEGLHTSGHGYRGELEEVL 321 >XP_017973853.1 PREDICTED: ribonuclease J isoform X2 [Theobroma cacao] Length = 739 Score = 72.8 bits (177), Expect = 6e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMG+NEGLHT GHGYRGEL VL Sbjct: 263 ESRVMKMLNRISEIGSTIVMGKNEGLHTSGHGYRGELEEVL 303 >ONI08004.1 hypothetical protein PRUPE_5G152800 [Prunus persica] Length = 768 Score = 72.8 bits (177), Expect = 7e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 303 EYRVMKILNRISEIGSTIVMGRNEGLHTFGHGYRGELASVL 181 E RVMK+LNRISEIGSTIVMG+NEGLHT GHGYRGEL VL Sbjct: 300 ESRVMKMLNRISEIGSTIVMGKNEGLHTSGHGYRGELEEVL 340