BLASTX nr result
ID: Phellodendron21_contig00039434
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039434 (412 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO72636.1 hypothetical protein CISIN_1g0091671mg, partial [Citr... 53 6e-07 >KDO72636.1 hypothetical protein CISIN_1g0091671mg, partial [Citrus sinensis] Length = 58 Score = 53.1 bits (126), Expect = 6e-07 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 412 STALRMAEILEAHPKVQLLFIVFLLCFSNG 323 STALRMAEILEAHPKV LLFI LLCF NG Sbjct: 22 STALRMAEILEAHPKVLLLFITLLLCFYNG 51