BLASTX nr result
ID: Phellodendron21_contig00039429
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039429 (397 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007407269.1 hypothetical protein MELLADRAFT_34476 [Melampsora... 72 4e-12 XP_009266215.1 Lanosterol synthase [Wallemia ichthyophaga EXF-99... 56 1e-06 XP_006956141.1 terpene synthase [Wallemia mellicola CBS 633.66] ... 56 2e-06 AEM61136.1 lanosterol synthase [Puccinia striiformis f. sp. trit... 56 2e-06 OAV98495.1 hypothetical protein PTTG_07326 [Puccinia triticina 1... 55 4e-06 XP_003330823.2 hypothetical protein PGTG_12360 [Puccinia gramini... 54 8e-06 >XP_007407269.1 hypothetical protein MELLADRAFT_34476 [Melampsora larici-populina 98AG31] EGG09542.1 hypothetical protein MELLADRAFT_34476 [Melampsora larici-populina 98AG31] Length = 731 Score = 72.0 bits (175), Expect = 4e-12 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 395 FNKTTSVMYPNYKFAWTIWALGKAYRQCDDITWA 294 FNKTTSVMYPNYKFAWTIWALGKAY++C DI W+ Sbjct: 697 FNKTTSVMYPNYKFAWTIWALGKAYKECRDIDWS 730 >XP_009266215.1 Lanosterol synthase [Wallemia ichthyophaga EXF-994] EOR03998.1 Lanosterol synthase [Wallemia ichthyophaga EXF-994] Length = 722 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -3 Query: 395 FNKTTSVMYPNYKFAWTIWALGKAYRQCDDITW 297 FNK ++ YPNYKF++TIWALGKAYR+ DI W Sbjct: 690 FNKNCAISYPNYKFSFTIWALGKAYREVGDIEW 722 >XP_006956141.1 terpene synthase [Wallemia mellicola CBS 633.66] EIM23592.1 terpene synthase [Wallemia mellicola CBS 633.66] Length = 724 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -3 Query: 395 FNKTTSVMYPNYKFAWTIWALGKAYRQCDDITW 297 FNK ++ YPNYKF++TIWALGKAYR+ DI W Sbjct: 690 FNKNCAISYPNYKFSFTIWALGKAYREFGDIDW 722 >AEM61136.1 lanosterol synthase [Puccinia striiformis f. sp. tritici] KNF01222.1 hypothetical protein PSTG_05579 [Puccinia striiformis f. sp. tritici PST-78] Length = 730 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 395 FNKTTSVMYPNYKFAWTIWALGKAYRQCDDITW 297 FNKTTSV YP+YKFAW+I ALGKA++Q D+ W Sbjct: 698 FNKTTSVTYPHYKFAWSIHALGKAHKQFPDVKW 730 >OAV98495.1 hypothetical protein PTTG_07326 [Puccinia triticina 1-1 BBBD Race 1] Length = 730 Score = 54.7 bits (130), Expect = 4e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -3 Query: 395 FNKTTSVMYPNYKFAWTIWALGKAYRQCDDITW 297 FNKTT+V YP+YKFAW+I ALGKA++Q D+ W Sbjct: 698 FNKTTAVTYPHYKFAWSICALGKAHKQFPDVEW 730 >XP_003330823.2 hypothetical protein PGTG_12360 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP86404.2 hypothetical protein PGTG_12360 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 797 Score = 53.9 bits (128), Expect = 8e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -3 Query: 395 FNKTTSVMYPNYKFAWTIWALGKAYRQCDDITW 297 FNKTTSV YP+YKFAW+I ALGKA+++ D+ W Sbjct: 765 FNKTTSVTYPHYKFAWSISALGKAHKRFPDVQW 797