BLASTX nr result
ID: Phellodendron21_contig00039428
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039428 (410 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016759258.1 hypothetical protein SEPMUDRAFT_134346 [Sphaeruli... 68 6e-12 XP_003855783.1 hypothetical protein MYCGRDRAFT_103030 [Zymosepto... 55 1e-07 >XP_016759258.1 hypothetical protein SEPMUDRAFT_134346 [Sphaerulina musiva SO2202] EMF11137.1 hypothetical protein SEPMUDRAFT_134346 [Sphaerulina musiva SO2202] Length = 143 Score = 68.2 bits (165), Expect = 6e-12 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = +3 Query: 78 MPRDGSGHSHNAVEAGEHIIHGQPTGNEQPTGFGVDRSSK 197 MPRDGSGHSHNA EAG +I HG P GNEQPT GVDRS K Sbjct: 1 MPRDGSGHSHNAEEAGHNIQHGAPQGNEQPTSSGVDRSGK 40 >XP_003855783.1 hypothetical protein MYCGRDRAFT_103030 [Zymoseptoria tritici IPO323] EGP90759.1 hypothetical protein MYCGRDRAFT_103030 [Zymoseptoria tritici IPO323] KJX95025.1 hypothetical protein TI39_contig4141g00006 [Zymoseptoria brevis] Length = 77 Score = 55.5 bits (132), Expect = 1e-07 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +3 Query: 78 MPRDGSGHSHNAVEAGEHIIHGQPTGNEQPTGFGVDRSSK 197 MPRDGSGHSHNAVE GE ++HG PTGN+ G VDRS K Sbjct: 1 MPRDGSGHSHNAVE-GEELVHGAPTGND-GKGSEVDRSDK 38