BLASTX nr result
ID: Phellodendron21_contig00039349
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039349 (322 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007416093.1 alpha/beta hydrolase [Melampsora larici-populina ... 88 3e-18 >XP_007416093.1 alpha/beta hydrolase [Melampsora larici-populina 98AG31] EGG00639.1 alpha/beta hydrolase [Melampsora larici-populina 98AG31] Length = 501 Score = 88.2 bits (217), Expect = 3e-18 Identities = 42/81 (51%), Positives = 56/81 (69%) Frame = -1 Query: 319 DCRAPARHKPEGASPVTVGSPMISDPQRPGEIGFQLVESKSAEDMVGVGDRVAKETIRDG 140 DC AP P+ S V++G PMI RP EIGFQL++ KSA +M +G+RVA+ET++D Sbjct: 417 DCSAPKDSLPQELSKVSIGGPMIKSITRPNEIGFQLIDIKSANEMECLGERVARETLKDA 476 Query: 139 ISIEFLKLLFWDGGRAALARK 77 S E+LKL+ WDGGR+ RK Sbjct: 477 QSWEYLKLVLWDGGRSWRERK 497