BLASTX nr result
ID: Phellodendron21_contig00039342
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039342 (312 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018391584.1 mitochondrial carrier [Alternaria alternata] OAG2... 90 2e-19 XP_018029791.1 mitochondrial carrier [Paraphaeosphaeria sporulos... 90 2e-19 XP_001939732.1 mitochondrial phosphate carrier protein [Pyrenoph... 88 1e-18 OAL48369.1 mitochondrial phosphate carrier protein [Pyrenochaeta... 88 1e-18 OAK97190.1 mitochondrial phosphate carrier protein [Stagonospora... 88 1e-18 XP_007692250.1 hypothetical protein COCMIDRAFT_106688 [Bipolaris... 88 1e-18 XP_007716582.1 hypothetical protein COCCADRAFT_107365 [Bipolaris... 88 1e-18 XP_008028986.1 hypothetical protein SETTUDRAFT_164656 [Setosphae... 88 1e-18 XP_014078477.1 hypothetical protein COCC4DRAFT_169749 [Bipolaris... 88 1e-18 XP_007700461.1 hypothetical protein COCSADRAFT_37597 [Bipolaris ... 88 1e-18 XP_003298322.1 hypothetical protein PTT_08990 [Pyrenophora teres... 88 1e-18 EKG11100.1 Mitochondrial substrate/solute carrier [Macrophomina ... 88 1e-18 KIV80532.1 hypothetical protein PV11_08025 [Exophiala sideris] 88 1e-18 OMP83559.1 Mitochondrial phosphate carrier protein 2 [Diplodia s... 87 2e-18 KKY23247.1 putative mitochondrial phosphate carrier protein [Dip... 87 2e-18 XP_007835204.1 Mitochondrial phosphate carrier protein 2 [Pestal... 86 6e-18 XP_007589533.1 putative mitochondrial phosphate carrier protein ... 85 7e-18 XP_007730914.1 mitochondrial phosphate carrier protein 2 [Capron... 85 9e-18 KXL46810.1 hypothetical protein FE78DRAFT_30583 [Acidomyces rich... 85 1e-17 EME45318.1 hypothetical protein DOTSEDRAFT_71146 [Dothistroma se... 85 1e-17 >XP_018391584.1 mitochondrial carrier [Alternaria alternata] OAG26163.1 mitochondrial carrier [Alternaria alternata] Length = 308 Score = 90.1 bits (222), Expect = 2e-19 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 312 GGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 269 GGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >XP_018029791.1 mitochondrial carrier [Paraphaeosphaeria sporulosa] OAF99425.1 mitochondrial carrier [Paraphaeosphaeria sporulosa] Length = 310 Score = 90.1 bits (222), Expect = 2e-19 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 312 GGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 271 GGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 310 >XP_001939732.1 mitochondrial phosphate carrier protein [Pyrenophora tritici-repentis Pt-1C-BFP] EDU42451.1 mitochondrial phosphate carrier protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 308 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 270 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >OAL48369.1 mitochondrial phosphate carrier protein [Pyrenochaeta sp. DS3sAY3a] Length = 308 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 270 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >OAK97190.1 mitochondrial phosphate carrier protein [Stagonospora sp. SRC1lsM3a] Length = 308 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 270 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >XP_007692250.1 hypothetical protein COCMIDRAFT_106688 [Bipolaris oryzae ATCC 44560] EUC41230.1 hypothetical protein COCMIDRAFT_106688 [Bipolaris oryzae ATCC 44560] Length = 308 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 270 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >XP_007716582.1 hypothetical protein COCCADRAFT_107365 [Bipolaris zeicola 26-R-13] XP_014552069.1 hypothetical protein COCVIDRAFT_19770 [Bipolaris victoriae FI3] EUC29120.1 hypothetical protein COCCADRAFT_107365 [Bipolaris zeicola 26-R-13] EUN22515.1 hypothetical protein COCVIDRAFT_19770 [Bipolaris victoriae FI3] Length = 308 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 270 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >XP_008028986.1 hypothetical protein SETTUDRAFT_164656 [Setosphaeria turcica Et28A] EOA83203.1 hypothetical protein SETTUDRAFT_164656 [Setosphaeria turcica Et28A] Length = 308 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 270 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >XP_014078477.1 hypothetical protein COCC4DRAFT_169749 [Bipolaris maydis ATCC 48331] EMD93043.1 hypothetical protein COCHEDRAFT_1193378 [Bipolaris maydis C5] ENI04568.1 hypothetical protein COCC4DRAFT_169749 [Bipolaris maydis ATCC 48331] Length = 308 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 270 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >XP_007700461.1 hypothetical protein COCSADRAFT_37597 [Bipolaris sorokiniana ND90Pr] EMD63847.1 hypothetical protein COCSADRAFT_37597 [Bipolaris sorokiniana ND90Pr] Length = 308 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 270 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >XP_003298322.1 hypothetical protein PTT_08990 [Pyrenophora teres f. teres 0-1] EFQ93588.1 hypothetical protein PTT_08990 [Pyrenophora teres f. teres 0-1] Length = 308 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 270 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 308 >EKG11100.1 Mitochondrial substrate/solute carrier [Macrophomina phaseolina MS6] Length = 309 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 271 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 309 >KIV80532.1 hypothetical protein PV11_08025 [Exophiala sideris] Length = 319 Score = 87.8 bits (216), Expect = 1e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 281 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 319 >OMP83559.1 Mitochondrial phosphate carrier protein 2 [Diplodia seriata] Length = 310 Score = 87.4 bits (215), Expect = 2e-18 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -1 Query: 312 GGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GGLWNGLPVRI MIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 271 GGLWNGLPVRIVMIGTLTAFQWLIYDSFKVYLGLPTTGGH 310 >KKY23247.1 putative mitochondrial phosphate carrier protein [Diplodia seriata] Length = 327 Score = 87.4 bits (215), Expect = 2e-18 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -1 Query: 312 GGLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GGLWNGLPVRI MIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 288 GGLWNGLPVRIVMIGTLTAFQWLIYDSFKVYLGLPTTGGH 327 >XP_007835204.1 Mitochondrial phosphate carrier protein 2 [Pestalotiopsis fici W106-1] ETS80903.1 Mitochondrial phosphate carrier protein 2 [Pestalotiopsis fici W106-1] Length = 308 Score = 85.9 bits (211), Expect = 6e-18 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVY GLPTTGGH Sbjct: 270 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYCGLPTTGGH 308 >XP_007589533.1 putative mitochondrial phosphate carrier protein [Neofusicoccum parvum UCRNP2] EOD42994.1 putative mitochondrial phosphate carrier protein [Neofusicoccum parvum UCRNP2] Length = 264 Score = 85.1 bits (209), Expect = 7e-18 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRI MIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 226 GLWNGLPVRIVMIGTLTAFQWLIYDSFKVYLGLPTTGGH 264 >XP_007730914.1 mitochondrial phosphate carrier protein 2 [Capronia epimyces CBS 606.96] EXJ89517.1 mitochondrial phosphate carrier protein 2 [Capronia epimyces CBS 606.96] Length = 283 Score = 85.1 bits (209), Expect = 9e-18 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRI MIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 245 GLWNGLPVRIVMIGTLTAFQWLIYDSFKVYLGLPTTGGH 283 >KXL46810.1 hypothetical protein FE78DRAFT_30583 [Acidomyces richmondensis] KYG50019.1 hypothetical protein M433DRAFT_57982 [Acidomyces richmondensis BFW] Length = 311 Score = 85.1 bits (209), Expect = 1e-17 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRI MIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 273 GLWNGLPVRIVMIGTLTAFQWLIYDSFKVYLGLPTTGGH 311 >EME45318.1 hypothetical protein DOTSEDRAFT_71146 [Dothistroma septosporum NZE10] Length = 311 Score = 85.1 bits (209), Expect = 1e-17 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 309 GLWNGLPVRIFMIGTLTAFQWLIYDSFKVYLGLPTTGGH 193 GLWNGLPVRI MIGTLTAFQWLIYDSFKVYLGLPTTGGH Sbjct: 273 GLWNGLPVRIVMIGTLTAFQWLIYDSFKVYLGLPTTGGH 311