BLASTX nr result
ID: Phellodendron21_contig00039272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039272 (393 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAV99151.1 hypothetical protein PTTG_09437 [Puccinia triticina 1... 80 3e-15 XP_003322222.2 hypothetical protein PGTG_03759 [Puccinia gramini... 80 5e-15 KNZ63924.1 hypothetical protein VP01_1084g6 [Puccinia sorghi] 78 2e-14 KNE92799.1 hypothetical protein PSTG_13783 [Puccinia striiformis... 76 1e-13 XP_007404222.1 hypothetical protein MELLADRAFT_88929 [Melampsora... 69 6e-11 XP_007404245.1 hypothetical protein MELLADRAFT_101624 [Melampsor... 67 2e-10 XP_007404248.1 hypothetical protein MELLADRAFT_101626 [Melampsor... 60 7e-08 >OAV99151.1 hypothetical protein PTTG_09437 [Puccinia triticina 1-1 BBBD Race 1] Length = 438 Score = 80.5 bits (197), Expect = 3e-15 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -3 Query: 208 MLHTDRGVDILVYGATGFTGKLVCAHLKSRYLDSSVPEDKLRIAIGGRSREK 53 MLHTDR +DI+VYGATGFTGKLVC HL+ RYLD S E+KL AIGGRS+EK Sbjct: 1 MLHTDRNIDIIVYGATGFTGKLVCQHLQKRYLDPSA-EEKLNWAIGGRSQEK 51 >XP_003322222.2 hypothetical protein PGTG_03759 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP77803.2 hypothetical protein PGTG_03759 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 424 Score = 80.1 bits (196), Expect = 5e-15 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -3 Query: 208 MLHTDRGVDILVYGATGFTGKLVCAHLKSRYLDSSVPEDKLRIAIGGRSREK 53 MLHTDR +DI+VYGATGFTGKLVC HL+ RYLD S E+KL AIGGRS+EK Sbjct: 1 MLHTDRNIDIIVYGATGFTGKLVCQHLQRRYLDPSA-EEKLNWAIGGRSQEK 51 >KNZ63924.1 hypothetical protein VP01_1084g6 [Puccinia sorghi] Length = 422 Score = 78.2 bits (191), Expect = 2e-14 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = -3 Query: 208 MLHTDRGVDILVYGATGFTGKLVCAHLKSRYLDSSVPEDKLRIAIGGRSREK 53 MLHTDR +DI+VYGATGFTGKLVC HL+SRYL+S E+ L AIGGRS+EK Sbjct: 1 MLHTDRNIDIIVYGATGFTGKLVCQHLQSRYLNS---EENLNWAIGGRSKEK 49 >KNE92799.1 hypothetical protein PSTG_13783 [Puccinia striiformis f. sp. tritici PST-78] Length = 424 Score = 76.3 bits (186), Expect = 1e-13 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -3 Query: 208 MLHTDRGVDILVYGATGFTGKLVCAHLKSRYLDSSVPEDKLRIAIGGRSREK 53 MLHTDR +DI+VYGATGFTGKLVC HL+ RYLD S E+ L AIGGRS+EK Sbjct: 1 MLHTDRNIDIVVYGATGFTGKLVCQHLQKRYLDPSSGEN-LNWAIGGRSQEK 51 >XP_007404222.1 hypothetical protein MELLADRAFT_88929 [Melampsora larici-populina 98AG31] EGG11847.1 hypothetical protein MELLADRAFT_88929 [Melampsora larici-populina 98AG31] Length = 427 Score = 68.6 bits (166), Expect = 6e-11 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = -3 Query: 208 MLHTDRGVDILVYGATGFTGKLVCAHLKSRYLD-SSVPEDKLRIAIGGRSREK 53 M H D+ +DI+VYGATGFTGKLVC + K++YLD + E+ L+I IGGRS+EK Sbjct: 1 MPHADQKIDIIVYGATGFTGKLVCTYFKTQYLDHNGSSEETLKIGIGGRSKEK 53 >XP_007404245.1 hypothetical protein MELLADRAFT_101624 [Melampsora larici-populina 98AG31] EGG11870.1 hypothetical protein MELLADRAFT_101624 [Melampsora larici-populina 98AG31] Length = 434 Score = 67.0 bits (162), Expect = 2e-10 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = -3 Query: 208 MLHTDRGVDILVYGATGFTGKLVCAHLKSRYLDSSVPEDK-LRIAIGGRSREK 53 M H D+ +DI+VYGATG+TGKLVC + K++YLD + D+ L+I IGGRS+EK Sbjct: 1 MPHADQTIDIIVYGATGYTGKLVCTYFKTQYLDHNGSSDETLKIGIGGRSKEK 53 >XP_007404248.1 hypothetical protein MELLADRAFT_101626 [Melampsora larici-populina 98AG31] EGG11873.1 hypothetical protein MELLADRAFT_101626 [Melampsora larici-populina 98AG31] Length = 465 Score = 59.7 bits (143), Expect = 7e-08 Identities = 27/52 (51%), Positives = 39/52 (75%), Gaps = 2/52 (3%) Frame = -3 Query: 202 HTDRGVDILVYGATGFTGKLVCAHLKSRYLD--SSVPEDKLRIAIGGRSREK 53 +TDR +DI+VYGAT + GKLVC HLK+ YL+ ++ ++I +GGRS+EK Sbjct: 4 NTDRELDIIVYGATSYVGKLVCEHLKNNYLNKYDVTSKESIKIGMGGRSKEK 55