BLASTX nr result
ID: Phellodendron21_contig00039251
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039251 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007416476.1 hypothetical protein MELLADRAFT_45503 [Melampsora... 69 3e-11 OAV96259.1 septin like spn2 [Puccinia triticina 1-1 BBBD Race 1] 67 9e-11 XP_003333869.1 septin like spn2 [Puccinia graminis f. sp. tritic... 67 9e-11 KNF03522.1 septin like spn2 [Puccinia striiformis f. sp. tritici... 66 2e-10 KNZ58230.1 uncharacterized protein VP01_1971g6 [Puccinia sorghi] 65 3e-10 KDE02952.1 septin like spn2 [Microbotryum lychnidis-dioicae p1A1... 64 2e-09 CEQ39891.1 SPOSA6832_01448 [Sporidiobolus salmonicolor] 62 7e-09 XP_018272030.1 hypothetical protein RHOBADRAFT_66310 [Rhodotorul... 61 1e-08 KWU46535.1 cell division/GTP binding protein [Rhodotorula sp. JG... 59 5e-08 KIJ44382.1 hypothetical protein M422DRAFT_168439, partial [Sphae... 55 2e-07 KIK61848.1 hypothetical protein GYMLUDRAFT_224105 [Gymnopus luxu... 57 3e-07 KYQ36198.1 Septin spn2 [Hypsizygus marmoreus] 57 5e-07 CUA70213.1 Septin homolog spn2 [Schizosaccharomyces pombe 972h-]... 56 7e-07 EUC57742.1 CDC10-septin, putative [Rhizoctonia solani AG-3 Rhs1A... 56 8e-07 OBZ69188.1 Septin spn2 [Grifola frondosa] 55 1e-06 XP_014569377.1 hypothetical protein L969DRAFT_93305 [Mixia osmun... 55 1e-06 OJT10933.1 Septin -like protein spn2 [Trametes pubescens] 55 1e-06 KZT02350.1 septin ring protein [Laetiporus sulphureus 93-53] 55 1e-06 CDO70008.1 hypothetical protein BN946_scf184354.g10 [Trametes ci... 55 1e-06 XP_008045351.1 septin ring protein [Trametes versicolor FP-10166... 55 1e-06 >XP_007416476.1 hypothetical protein MELLADRAFT_45503 [Melampsora larici-populina 98AG31] EGG00277.1 hypothetical protein MELLADRAFT_45503 [Melampsora larici-populina 98AG31] Length = 315 Score = 68.6 bits (166), Expect = 3e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +2 Query: 245 MVEDAITRLNSYVGFDSITRQIEHKLLKRGFQFNV 349 M +D++TRLNSYVGFDSITRQIEHKLLKRGFQFNV Sbjct: 1 MADDSVTRLNSYVGFDSITRQIEHKLLKRGFQFNV 35 >OAV96259.1 septin like spn2 [Puccinia triticina 1-1 BBBD Race 1] Length = 318 Score = 67.0 bits (162), Expect = 9e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 245 MVEDAITRLNSYVGFDSITRQIEHKLLKRGFQFN 346 M ++AITRLNSYVGFDSITRQIEHKLLKRGFQFN Sbjct: 1 MADEAITRLNSYVGFDSITRQIEHKLLKRGFQFN 34 >XP_003333869.1 septin like spn2 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP89450.1 septin like spn2 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 318 Score = 67.0 bits (162), Expect = 9e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 245 MVEDAITRLNSYVGFDSITRQIEHKLLKRGFQFN 346 M ++AITRLNSYVGFDSITRQIEHKLLKRGFQFN Sbjct: 1 MADEAITRLNSYVGFDSITRQIEHKLLKRGFQFN 34 >KNF03522.1 septin like spn2 [Puccinia striiformis f. sp. tritici PST-78] Length = 319 Score = 65.9 bits (159), Expect = 2e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 245 MVEDAITRLNSYVGFDSITRQIEHKLLKRGFQFN 346 + ++AITRLNSYVGFDSITRQIEHKLLKRGFQFN Sbjct: 3 LADEAITRLNSYVGFDSITRQIEHKLLKRGFQFN 36 >KNZ58230.1 uncharacterized protein VP01_1971g6 [Puccinia sorghi] Length = 319 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +2 Query: 245 MVEDAITRLNSYVGFDSITRQIEHKLLKRGFQFN 346 M ++ ITRLNSYVGFDSITRQIEHKLLKRGFQFN Sbjct: 1 MADETITRLNSYVGFDSITRQIEHKLLKRGFQFN 34 >KDE02952.1 septin like spn2 [Microbotryum lychnidis-dioicae p1A1 Lamole] Length = 326 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 260 ITRLNSYVGFDSITRQIEHKLLKRGFQFNV 349 ITRLNSYVGFDSITRQIEHKLLKRGFQFNV Sbjct: 14 ITRLNSYVGFDSITRQIEHKLLKRGFQFNV 43 >CEQ39891.1 SPOSA6832_01448 [Sporidiobolus salmonicolor] Length = 365 Score = 62.0 bits (149), Expect = 7e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +2 Query: 263 TRLNSYVGFDSITRQIEHKLLKRGFQFNV 349 TRLNSYVGFDSITRQIEHKLLKRGFQFNV Sbjct: 15 TRLNSYVGFDSITRQIEHKLLKRGFQFNV 43 >XP_018272030.1 hypothetical protein RHOBADRAFT_66310 [Rhodotorula graminis WP1] KPV75981.1 hypothetical protein RHOBADRAFT_66310 [Rhodotorula graminis WP1] Length = 324 Score = 61.2 bits (147), Expect = 1e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +2 Query: 254 DAITRLNSYVGFDSITRQIEHKLLKRGFQFNV 349 ++ TRLNSYVGFDSIT+QIEHKLLKRGFQFNV Sbjct: 10 ESTTRLNSYVGFDSITQQIEHKLLKRGFQFNV 41 >KWU46535.1 cell division/GTP binding protein [Rhodotorula sp. JG-1b] Length = 326 Score = 59.3 bits (142), Expect = 5e-08 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = +2 Query: 254 DAITRLNSYVGFDSITRQIEHKLLKRGFQFNV 349 +++TRL+SYVGFDSITRQIE+KLLKRGFQFNV Sbjct: 11 ESLTRLSSYVGFDSITRQIENKLLKRGFQFNV 42 >KIJ44382.1 hypothetical protein M422DRAFT_168439, partial [Sphaerobolus stellatus SS14] Length = 117 Score = 55.1 bits (131), Expect = 2e-07 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +2 Query: 266 RLNSYVGFDSITRQIEHKLLKRGFQFNV 349 R SYVGFDSITRQIEHKLLKRGFQFNV Sbjct: 16 RAASYVGFDSITRQIEHKLLKRGFQFNV 43 >KIK61848.1 hypothetical protein GYMLUDRAFT_224105 [Gymnopus luxurians FD-317 M1] Length = 312 Score = 57.0 bits (136), Expect = 3e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 266 RLNSYVGFDSITRQIEHKLLKRGFQFNV 349 R NSYVGFDSIT+QIEHKLLKRGFQFNV Sbjct: 6 RANSYVGFDSITKQIEHKLLKRGFQFNV 33 >KYQ36198.1 Septin spn2 [Hypsizygus marmoreus] Length = 315 Score = 56.6 bits (135), Expect = 5e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 266 RLNSYVGFDSITRQIEHKLLKRGFQFNV 349 R NSYVGFDSIT+QIEHKLLKRGFQFNV Sbjct: 10 RANSYVGFDSITQQIEHKLLKRGFQFNV 37 >CUA70213.1 Septin homolog spn2 [Schizosaccharomyces pombe 972h-] [Rhizoctonia solani] Length = 406 Score = 56.2 bits (134), Expect = 7e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 266 RLNSYVGFDSITRQIEHKLLKRGFQFNV 349 R +SYVGFDSITRQIEHKLLKRGFQFNV Sbjct: 99 RASSYVGFDSITRQIEHKLLKRGFQFNV 126 >EUC57742.1 CDC10-septin, putative [Rhizoctonia solani AG-3 Rhs1AP] KEP50266.1 putative CDC10-septin [Rhizoctonia solani 123E] Length = 465 Score = 56.2 bits (134), Expect = 8e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 266 RLNSYVGFDSITRQIEHKLLKRGFQFNV 349 R +SYVGFDSITRQIEHKLLKRGFQFNV Sbjct: 157 RASSYVGFDSITRQIEHKLLKRGFQFNV 184 >OBZ69188.1 Septin spn2 [Grifola frondosa] Length = 286 Score = 55.5 bits (132), Expect = 1e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 266 RLNSYVGFDSITRQIEHKLLKRGFQFNV 349 R NSYVGFD+IT+QIEHKLLKRGFQFNV Sbjct: 13 RANSYVGFDTITQQIEHKLLKRGFQFNV 40 >XP_014569377.1 hypothetical protein L969DRAFT_93305 [Mixia osmundae IAM 14324] GAA98076.1 hypothetical protein E5Q_04758 [Mixia osmundae IAM 14324] KEI40773.1 hypothetical protein L969DRAFT_93305 [Mixia osmundae IAM 14324] Length = 315 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +2 Query: 263 TRLNSYVGFDSITRQIEHKLLKRGFQFNV 349 TRL SYVGFD+ITRQIE KLLKRGFQFNV Sbjct: 7 TRLQSYVGFDTITRQIEQKLLKRGFQFNV 35 >OJT10933.1 Septin -like protein spn2 [Trametes pubescens] Length = 317 Score = 55.5 bits (132), Expect = 1e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 266 RLNSYVGFDSITRQIEHKLLKRGFQFNV 349 R NSYVGFD+IT+QIEHKLLKRGFQFNV Sbjct: 10 RANSYVGFDTITQQIEHKLLKRGFQFNV 37 >KZT02350.1 septin ring protein [Laetiporus sulphureus 93-53] Length = 317 Score = 55.5 bits (132), Expect = 1e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 266 RLNSYVGFDSITRQIEHKLLKRGFQFNV 349 R NSYVGFD+IT+QIEHKLLKRGFQFNV Sbjct: 10 RANSYVGFDTITQQIEHKLLKRGFQFNV 37 >CDO70008.1 hypothetical protein BN946_scf184354.g10 [Trametes cinnabarina] Length = 317 Score = 55.5 bits (132), Expect = 1e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 266 RLNSYVGFDSITRQIEHKLLKRGFQFNV 349 R NSYVGFD+IT+QIEHKLLKRGFQFNV Sbjct: 10 RANSYVGFDTITQQIEHKLLKRGFQFNV 37 >XP_008045351.1 septin ring protein [Trametes versicolor FP-101664 SS1] EIW51805.1 septin ring protein [Trametes versicolor FP-101664 SS1] Length = 317 Score = 55.5 bits (132), Expect = 1e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 266 RLNSYVGFDSITRQIEHKLLKRGFQFNV 349 R NSYVGFD+IT+QIEHKLLKRGFQFNV Sbjct: 10 RANSYVGFDTITQQIEHKLLKRGFQFNV 37