BLASTX nr result
ID: Phellodendron21_contig00039208
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039208 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003322015.1 hypothetical protein PGTG_03552 [Puccinia gramini... 57 3e-07 OAV93516.1 hypothetical protein PTTG_00834 [Puccinia triticina 1... 57 3e-07 KNF00824.1 hypothetical protein PSTG_05958 [Puccinia striiformis... 57 3e-07 XP_019025340.1 hypothetical protein SAICODRAFT_64966 [Saitoella ... 52 8e-06 GAO48564.1 hypothetical protein G7K_2737-t1 [Saitoella complicat... 52 9e-06 XP_013245628.1 Snf7-domain-containing protein [Tilletiaria anoma... 52 9e-06 >XP_003322015.1 hypothetical protein PGTG_03552 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP77596.1 hypothetical protein PGTG_03552 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 222 Score = 56.6 bits (135), Expect = 3e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 238 MGQAASSAHRITSQDRAILDMKLQRDKLKQYQK 336 MGQ SS RIT+QDRAILDMKLQRDKLKQYQK Sbjct: 1 MGQGRSSQARITNQDRAILDMKLQRDKLKQYQK 33 >OAV93516.1 hypothetical protein PTTG_00834 [Puccinia triticina 1-1 BBBD Race 1] Length = 228 Score = 56.6 bits (135), Expect = 3e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 238 MGQAASSAHRITSQDRAILDMKLQRDKLKQYQK 336 MGQ SS RITSQDRAILDMKLQRDKL+QYQK Sbjct: 1 MGQGRSSQPRITSQDRAILDMKLQRDKLRQYQK 33 >KNF00824.1 hypothetical protein PSTG_05958 [Puccinia striiformis f. sp. tritici PST-78] Length = 228 Score = 56.6 bits (135), Expect = 3e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 238 MGQAASSAHRITSQDRAILDMKLQRDKLKQYQK 336 MGQ SS RIT+QDRAILDMKLQRDKLKQYQK Sbjct: 1 MGQGRSSQTRITNQDRAILDMKLQRDKLKQYQK 33 >XP_019025340.1 hypothetical protein SAICODRAFT_64966 [Saitoella complicata NRRL Y-17804] ODQ54227.1 hypothetical protein SAICODRAFT_64966 [Saitoella complicata NRRL Y-17804] Length = 204 Score = 52.4 bits (124), Expect = 8e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 253 SSAHRITSQDRAILDMKLQRDKLKQYQK 336 SSA R+T QDRAILDMKLQRDKLKQYQK Sbjct: 5 SSARRVTPQDRAILDMKLQRDKLKQYQK 32 >GAO48564.1 hypothetical protein G7K_2737-t1 [Saitoella complicata NRRL Y-17804] Length = 214 Score = 52.4 bits (124), Expect = 9e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 253 SSAHRITSQDRAILDMKLQRDKLKQYQK 336 SSA R+T QDRAILDMKLQRDKLKQYQK Sbjct: 5 SSARRVTPQDRAILDMKLQRDKLKQYQK 32 >XP_013245628.1 Snf7-domain-containing protein [Tilletiaria anomala UBC 951] KDN52789.1 Snf7-domain-containing protein [Tilletiaria anomala UBC 951] Length = 217 Score = 52.4 bits (124), Expect = 9e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 238 MGQAASSAHRITSQDRAILDMKLQRDKLKQYQK 336 MGQ S +IT+QDRAILD+KLQRDK+KQYQK Sbjct: 1 MGQQGSKGPKITAQDRAILDLKLQRDKIKQYQK 33