BLASTX nr result
ID: Phellodendron21_contig00039074
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039074 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EOY28176.1 Uncharacterized protein TCM_029816 [Theobroma cacao] 89 4e-21 OAY26229.1 hypothetical protein MANES_16G031000 [Manihot esculenta] 83 5e-19 KMT04609.1 hypothetical protein BVRB_8g182630 [Beta vulgaris sub... 69 1e-13 KHN18952.1 hypothetical protein glysoja_036131 [Glycine soja] 64 4e-11 ABR16782.1 unknown [Picea sitchensis] 56 2e-08 EEF50827.1 pentatricopeptide repeat-containing protein, putative... 59 2e-07 >EOY28176.1 Uncharacterized protein TCM_029816 [Theobroma cacao] Length = 44 Score = 88.6 bits (218), Expect = 4e-21 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -3 Query: 343 MLELFVLGCTGVVVFLHGASFFFHVLSQHLAVRSLSFLGFVGW 215 M+ELFVLGCTGVVVFLHGA+FFFH+LSQHLAVRSLSFLGFVGW Sbjct: 2 MVELFVLGCTGVVVFLHGANFFFHILSQHLAVRSLSFLGFVGW 44 >OAY26229.1 hypothetical protein MANES_16G031000 [Manihot esculenta] Length = 44 Score = 83.2 bits (204), Expect = 5e-19 Identities = 35/43 (81%), Positives = 43/43 (100%) Frame = -3 Query: 343 MLELFVLGCTGVVVFLHGASFFFHVLSQHLAVRSLSFLGFVGW 215 ++ELF+LGCTGVV+FLHGA+FFFH+L+QHLA+RSLSFLGFVGW Sbjct: 2 VVELFLLGCTGVVMFLHGANFFFHILTQHLAIRSLSFLGFVGW 44 >KMT04609.1 hypothetical protein BVRB_8g182630 [Beta vulgaris subsp. vulgaris] Length = 44 Score = 69.3 bits (168), Expect = 1e-13 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 343 MLELFVLGCTGVVVFLHGASFFFHVLSQHLAVRSLSFLGFVGW 215 ++ELFVLGCTG+V+F HGA FH L H+A+RSLSFLGFVGW Sbjct: 2 VVELFVLGCTGMVMFYHGAHVLFHALFSHVALRSLSFLGFVGW 44 >KHN18952.1 hypothetical protein glysoja_036131 [Glycine soja] Length = 78 Score = 63.9 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 343 MLELFVLGCTGVVVFLHGASFFFHVLSQHLAVRSLS 236 M+E+ VLGCTGVVVFLHGA FFFH L+QH+A+RSLS Sbjct: 1 MMEVLVLGCTGVVVFLHGAHFFFHALTQHIALRSLS 36 >ABR16782.1 unknown [Picea sitchensis] Length = 41 Score = 55.8 bits (133), Expect = 2e-08 Identities = 25/41 (60%), Positives = 36/41 (87%) Frame = -3 Query: 343 MLELFVLGCTGVVVFLHGASFFFHVLSQHLAVRSLSFLGFV 221 ML+L +LGCTGV+VF+HGA+FFF+ + +H+AVR+L+FL V Sbjct: 1 MLDL-LLGCTGVIVFIHGANFFFNYICKHVAVRALTFLSHV 40 >EEF50827.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 678 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/37 (75%), Positives = 33/37 (89%), Gaps = 2/37 (5%) Frame = -3 Query: 343 MLELFVLG--CTGVVVFLHGASFFFHVLSQHLAVRSL 239 ++E+FVLG CTGVV+FLHGA+FFFHVLS HLA RSL Sbjct: 2 VVEIFVLGMGCTGVVMFLHGANFFFHVLSHHLAFRSL 38